Recombinant Human NS1-BP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NS1-BP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human IVNS1ABP partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
IVNS1ABP
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NS1-BP Protein

  • ARA3
  • aryl hydrocarbon receptor-associated 3
  • Aryl hydrocarbon receptor-associated protein 3
  • DKFZp686K06216
  • FLARA3
  • FLJ10962
  • FLJ35593
  • FLJ36593
  • HSPC068
  • influenza virus NS1A binding protein
  • influenza virus NS1A-binding protein
  • KIAA0850FLJ10069
  • KLHL39
  • NCX downstream gene 1
  • ND1
  • NS1
  • NS-1
  • NS1-binding protein
  • NS1BP
  • NS1-BPFLJ10411

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-07799
Species: Hu
NBP1-88936
Species: Hu
Applications: IHC, IHC-P
NBP2-14110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-70650
Species: Hu
Applications: WB
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NS1-BP Partial Recombinant Protein (H00010625-Q01) (0)

There are no publications for NS1-BP Partial Recombinant Protein (H00010625-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NS1-BP Partial Recombinant Protein (H00010625-Q01) (0)

There are no reviews for NS1-BP Partial Recombinant Protein (H00010625-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NS1-BP Partial Recombinant Protein (H00010625-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NS1-BP Products

Bioinformatics Tool for NS1-BP Partial Recombinant Protein (H00010625-Q01)

Discover related pathways, diseases and genes to NS1-BP Partial Recombinant Protein (H00010625-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NS1-BP Partial Recombinant Protein (H00010625-Q01)

Discover more about diseases related to NS1-BP Partial Recombinant Protein (H00010625-Q01).
 

Pathways for NS1-BP Partial Recombinant Protein (H00010625-Q01)

View related products by pathway.

Blogs on NS1-BP

There are no specific blogs for NS1-BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NS1-BP Antibody
NBP2-24567

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NS1-BP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IVNS1ABP