NS1-BP Antibody


Western Blot: NS1-BP Antibody [NBP1-53044] - K562 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: NS1-BP Antibody [NBP1-53044] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NS1-BP Antibody Summary

Synthetic peptides corresponding to IVNS1ABP (influenza virus NS1A binding protein) The peptide sequence was selected from the N terminal of IVNS1ABP. Peptide sequence RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against IVNS1ABP and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
NS1-BP Lysate (NBP2-65369)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NS1-BP Antibody

  • ARA3
  • aryl hydrocarbon receptor-associated 3
  • Aryl hydrocarbon receptor-associated protein 3
  • DKFZp686K06216
  • FLARA3
  • FLJ10962
  • FLJ35593
  • FLJ36593
  • HSPC068
  • influenza virus NS1A binding protein
  • influenza virus NS1A-binding protein
  • KIAA0850FLJ10069
  • KLHL39
  • NCX downstream gene 1
  • ND1
  • NS1
  • NS-1
  • NS1-binding protein
  • NS1BP
  • NS1-BPFLJ10411


This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NS1-BP Antibody (NBP1-53044) (0)

There are no publications for NS1-BP Antibody (NBP1-53044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NS1-BP Antibody (NBP1-53044) (0)

There are no reviews for NS1-BP Antibody (NBP1-53044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NS1-BP Antibody (NBP1-53044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional NS1-BP Products

Bioinformatics Tool for NS1-BP Antibody (NBP1-53044)

Discover related pathways, diseases and genes to NS1-BP Antibody (NBP1-53044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NS1-BP Antibody (NBP1-53044)

Discover more about diseases related to NS1-BP Antibody (NBP1-53044).

Pathways for NS1-BP Antibody (NBP1-53044)

View related products by pathway.

Blogs on NS1-BP

There are no specific blogs for NS1-BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NS1-BP Antibody and receive a gift card or discount.


Gene Symbol IVNS1ABP