NRIP Antibody


Immunocytochemistry/ Immunofluorescence: NRIP Antibody [NBP2-55070] - Staining of human cell line U-2 OS shows localization to nucleus, cytosol & focal adhesion sites.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

NRIP Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EDVTKYQEGVSAENPVENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPEESASSEKAKEPETSDQTSTESATNENNTNPEPQFQTEATG
Specificity of human NRIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NRIP Antibody

  • 1200006M05Rik
  • Androgen receptor complex-associated protein
  • DDB1 and CUL4 associated factor 6
  • DDB1- and CUL4-associated factor 6
  • FLJ23798
  • IQ motif and WD repeat-containing protein 1
  • IQ motif and WD repeats 1
  • IQWD1
  • MSTP055
  • NRIP
  • Nuclear receptor interaction protein
  • PC326


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Po, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ICC/IF

Publications for NRIP Antibody (NBP2-55070) (0)

There are no publications for NRIP Antibody (NBP2-55070).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRIP Antibody (NBP2-55070) (0)

There are no reviews for NRIP Antibody (NBP2-55070). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NRIP Antibody (NBP2-55070) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NRIP Products

Bioinformatics Tool for NRIP Antibody (NBP2-55070)

Discover related pathways, diseases and genes to NRIP Antibody (NBP2-55070). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRIP Antibody (NBP2-55070)

Discover more about diseases related to NRIP Antibody (NBP2-55070).

Pathways for NRIP Antibody (NBP2-55070)

View related products by pathway.

PTMs for NRIP Antibody (NBP2-55070)

Learn more about PTMs related to NRIP Antibody (NBP2-55070).

Blogs on NRIP

There are no specific blogs for NRIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NRIP Antibody and receive a gift card or discount.


Gene Symbol DCAF6