Recombinant Human NPY1R Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related NPY1R Peptides and Proteins

Order Details


    • Catalog Number
      H00004886-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human NPY1R Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 384 of Human NPY1R full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVPITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVYDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NPY1R
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
67.98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NPY1R Protein

  • neuropeptide Y receptor type 1
  • neuropeptide Y receptor Y1
  • NPY1R
  • NPY1-R
  • NPYR
  • NPYY1

Background

Neuropeptide Y (NPY; MIM 162640) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle (Herzog et al., 1992 [PubMed 1321422]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-46813
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-59978
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1538
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP1-89515
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq

Publications for NPY1R Recombinant Protein (H00004886-P01) (0)

There are no publications for NPY1R Recombinant Protein (H00004886-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPY1R Recombinant Protein (H00004886-P01) (0)

There are no reviews for NPY1R Recombinant Protein (H00004886-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NPY1R Recombinant Protein (H00004886-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NPY1R Products

Bioinformatics Tool for NPY1R Recombinant Protein (H00004886-P01)

Discover related pathways, diseases and genes to NPY1R Recombinant Protein (H00004886-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPY1R Recombinant Protein (H00004886-P01)

Discover more about diseases related to NPY1R Recombinant Protein (H00004886-P01).
 

Pathways for NPY1R Recombinant Protein (H00004886-P01)

View related products by pathway.

PTMs for NPY1R Recombinant Protein (H00004886-P01)

Learn more about PTMs related to NPY1R Recombinant Protein (H00004886-P01).

Blogs on NPY1R

There are no specific blogs for NPY1R, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NPY1R Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPY1R
Entrez