NPM1 Antibody (3B2)

Images

 
Western Blot: NPM1 Antibody (3B2) [H00004869-M01] - NPM1 monoclonal antibody (M01), clone 3B2 Analysis of NPM1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: NPM1 Antibody (3B2) [H00004869-M01] - Analysis of monoclonal antibody to NPM1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: NPM1 Antibody (3B2) [H00004869-M01] - Analysis of monoclonal antibody to NPM1 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. Antibody concentration 5 ug/ml.
Sandwich ELISA: NPM1 Antibody (3B2) [H00004869-M01] - Detection limit for recombinant GST tagged NPM1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
3B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NPM1 Antibody (3B2) Summary

Immunogen
NPM1 (AAH02398.1, 1 a.a. - 294 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Specificity
NPM1 - nucleophosmin (nucleolar phosphoprotein B23, numatrin)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NPM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using H00004869-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NPM1 Antibody (3B2)

  • B23
  • MGC104254
  • NPM1
  • NPMnucleophosmin/nucleoplasmin family, member 1
  • Nucleolar phosphoprotein B23
  • Nucleolar protein NO38
  • nucleophosmin (nucleolar phosphoprotein B23, numatrin)
  • Nucleophosmin
  • Numatrin

Background

NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00004869-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for NPM1 Antibody (H00004869-M01)(1)

Reviews for NPM1 Antibody (H00004869-M01) (0)

There are no reviews for NPM1 Antibody (H00004869-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NPM1 Antibody (H00004869-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPM1 Products

Bioinformatics Tool for NPM1 Antibody (H00004869-M01)

Discover related pathways, diseases and genes to NPM1 Antibody (H00004869-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPM1 Antibody (H00004869-M01)

Discover more about diseases related to NPM1 Antibody (H00004869-M01).
 

Pathways for NPM1 Antibody (H00004869-M01)

View related products by pathway.

PTMs for NPM1 Antibody (H00004869-M01)

Learn more about PTMs related to NPM1 Antibody (H00004869-M01).
 

Research Areas for NPM1 Antibody (H00004869-M01)

Find related products by research area.

Blogs on NPM1

There are no specific blogs for NPM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPM1 Antibody (3B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol NPM1
Entrez
Uniprot