Nox4 Partial Protein

Product Discontinued

Nox4 Partial Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 479-578 of Human NOX4 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Partial Protein
• Gene: NOX4

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nox4 Partial Protein

• EC 1.6.3
• Kidney oxidase-1
• Kidney superoxide-producing NADPH oxidase
• KOX
• KOX-1
• KOX-1Renal NAD(P)H-oxidase
• NADPH oxidase 4
• Nox4
• RENOX
• RENOXEC 1.6.3.-

Background

Oxygen sensing is essential for homeostasis in all aerobic organisms. A phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes, with resultant antimicrobial activity, has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin (EPO; MIM 133170) in the renal cortex.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOX4