Notch-3 Antibody (2E2.) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Notch-3 Primary Antibodies

Order Details


    • Catalog Number
      H00004854-M02V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Notch-3 Antibody (2E2.) [DyLight 405] Summary

Immunogen
NOTCH3 (NP_000426, 47 a.a. - 156 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Specificity
NOTCH3 (2E2)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NOTCH3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Notch-3 Antibody (2E2.) [DyLight 405]

  • CADASIL
  • CASILneurogenic locus notch homolog protein 3
  • Notch (Drosophila) homolog 3
  • notch 3Notch homolog 3 (Drosophila)
  • Notch homolog 3
  • Notch3
  • Notch-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
AF1277
Species: Hu
Applications: WB, IHC, Neut
AF1726
Species: Hu
Applications: WB, IHC, ICC
AF1389
Species: Mu
Applications: WB, ICC
NBP2-16818
Species: Hu
Applications: WB, ICC/IF
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-57809
Species: Hu
Applications: ICC/IF
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23869
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF
H00004854-M02V
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Notch-3 Antibody (H00004854-M02V) (0)

There are no publications for Notch-3 Antibody (H00004854-M02V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Notch-3 Antibody (H00004854-M02V) (0)

There are no reviews for Notch-3 Antibody (H00004854-M02V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Notch-3 Antibody (H00004854-M02V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Notch-3 Antibody (2E2.) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for Notch-3 Antibody (H00004854-M02V)

Discover related pathways, diseases and genes to Notch-3 Antibody (H00004854-M02V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Notch-3 Antibody (H00004854-M02V)

Discover more about diseases related to Notch-3 Antibody (H00004854-M02V).
 

Pathways for Notch-3 Antibody (H00004854-M02V)

View related products by pathway.

PTMs for Notch-3 Antibody (H00004854-M02V)

Learn more about PTMs related to Notch-3 Antibody (H00004854-M02V).
 

Research Areas for Notch-3 Antibody (H00004854-M02V)

Find related products by research area.

Blogs on Notch-3

There are no specific blogs for Notch-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Notch-3 Antibody (2E2.) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol NOTCH3
Entrez
Uniprot