non-muscle Myosin IIA Antibody


Western Blot: non-muscle Myosin IIA Antibody [NBP1-54919] - Hek 293 Whole Cell Lysate at 1:4,000.
Western Blot: non-muscle Myosin IIA Antibody [NBP1-54919] - MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related non-muscle Myosin IIA Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

non-muscle Myosin IIA Antibody Summary

Synthetic peptides corresponding to MYH9(myosin, heavy chain 9, non-muscle) The peptide sequence was selected from the middle region of MYH9. Peptide sequence DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MYH9 and was validated on Western blot.
Theoretical MW
226 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for non-muscle Myosin IIA Antibody

  • Cellular myosin heavy chain, type A
  • DFNA17
  • MGC104539
  • MYH9 variant protein
  • Myosin heavy chain 9
  • Myosin heavy chain, non-muscle IIa
  • myosin, heavy chain 9, non-muscle
  • myosin, heavy polypeptide 9, non-muscle
  • myosin-9
  • Non-muscle myosin heavy chain A
  • Non-muscle myosin heavy chain IIa
  • nonmuscle myosin heavy chain II-A
  • non-muscle myosin heavy polypeptide 9


MYH9 is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Rb
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Mu
Applications: WB, IHC

Publications for non-muscle Myosin IIA Antibody (NBP1-54919) (0)

There are no publications for non-muscle Myosin IIA Antibody (NBP1-54919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for non-muscle Myosin IIA Antibody (NBP1-54919) (0)

There are no reviews for non-muscle Myosin IIA Antibody (NBP1-54919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for non-muscle Myosin IIA Antibody (NBP1-54919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional non-muscle Myosin IIA Products

Bioinformatics Tool for non-muscle Myosin IIA Antibody (NBP1-54919)

Discover related pathways, diseases and genes to non-muscle Myosin IIA Antibody (NBP1-54919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for non-muscle Myosin IIA Antibody (NBP1-54919)

Discover more about diseases related to non-muscle Myosin IIA Antibody (NBP1-54919).

Pathways for non-muscle Myosin IIA Antibody (NBP1-54919)

View related products by pathway.

PTMs for non-muscle Myosin IIA Antibody (NBP1-54919)

Learn more about PTMs related to non-muscle Myosin IIA Antibody (NBP1-54919).

Research Areas for non-muscle Myosin IIA Antibody (NBP1-54919)

Find related products by research area.

Blogs on non-muscle Myosin IIA

There are no specific blogs for non-muscle Myosin IIA, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our non-muscle Myosin IIA Antibody and receive a gift card or discount.


Gene Symbol MYH9