NOLC1 Antibody


Immunocytochemistry/ Immunofluorescence: NOLC1 Antibody [NBP1-83058] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-83058] - Staining of human cerebral cortex shows moderate nucleolar positivity in neuronal cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

NOLC1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQANGPVAKKAKKK
Specificity of human NOLC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NOLC1 Antibody

  • 140 kDa nucleolar phosphoprotein
  • HCV NS5A trans-regulated protein 13
  • HCV NS5A-transactivated protein 13
  • Hepatitis C virus NS5A-transactivated protein 13
  • KIAA0035NS5ATP13
  • NOPP130
  • NOPP140
  • Nucleolar 130 kDa protein
  • nucleolar and coiled-body phosphoprotein 1
  • nucleolar and coiled-body phosphprotein 1
  • Nucleolar phosphoprotein p130
  • nucleolar protein p130
  • P130


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Ch, Pm, Rb, RM, Xp, Ze
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for NOLC1 Antibody (NBP1-83058) (0)

There are no publications for NOLC1 Antibody (NBP1-83058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOLC1 Antibody (NBP1-83058) (0)

There are no reviews for NOLC1 Antibody (NBP1-83058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NOLC1 Antibody (NBP1-83058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NOLC1 Products

Bioinformatics Tool for NOLC1 Antibody (NBP1-83058)

Discover related pathways, diseases and genes to NOLC1 Antibody (NBP1-83058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOLC1 Antibody (NBP1-83058)

Discover more about diseases related to NOLC1 Antibody (NBP1-83058).

Pathways for NOLC1 Antibody (NBP1-83058)

View related products by pathway.

PTMs for NOLC1 Antibody (NBP1-83058)

Learn more about PTMs related to NOLC1 Antibody (NBP1-83058).

Research Areas for NOLC1 Antibody (NBP1-83058)

Find related products by research area.

Blogs on NOLC1

There are no specific blogs for NOLC1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NOLC1 Antibody and receive a gift card or discount.


Gene Symbol NOLC1
COVID-19 update