NOL11 Antibody

Images

 
Western Blot: NOL11 Antibody [NBP2-83284] - Host: Rabbit. Target Name: NOL11. Sample Type: THP-1 Whole Cell. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOL11 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NOL11. Peptide sequence: QFLVTDSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NOL11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOL11 Antibody

  • nucleolar protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-97838
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-93788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP3-09260
Species: Hu
Applications: WB
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
H00006159-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87372
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32572
Species: Hu
Applications: WB, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP2-83284
Species: Hu
Applications: WB

Publications for NOL11 Antibody (NBP2-83284) (0)

There are no publications for NOL11 Antibody (NBP2-83284).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOL11 Antibody (NBP2-83284) (0)

There are no reviews for NOL11 Antibody (NBP2-83284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOL11 Antibody (NBP2-83284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NOL11 Products

Array NBP2-83284

Bioinformatics Tool for NOL11 Antibody (NBP2-83284)

Discover related pathways, diseases and genes to NOL11 Antibody (NBP2-83284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOL11 Antibody (NBP2-83284)

Discover more about diseases related to NOL11 Antibody (NBP2-83284).
 

Pathways for NOL11 Antibody (NBP2-83284)

View related products by pathway.

PTMs for NOL11 Antibody (NBP2-83284)

Learn more about PTMs related to NOL11 Antibody (NBP2-83284).

Blogs on NOL11

There are no specific blogs for NOL11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOL11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOL11