Nogo Antibody

Images

 
Western Blot: NOGO Antibody [NBP1-69286] - This Anti-RTN4 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nogo Antibody Summary

Immunogen
Synthetic peptides corresponding to Nogo The peptide sequence was selected from the middle region of Nogo. Peptide sequence FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RTN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RTN4 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nogo Antibody

  • ASY
  • foocen
  • Human NogoA
  • KIAA0886
  • My043 protein
  • Nbla00271
  • Nbla10545
  • neurite growth inhibitor 220
  • Neurite outgrowth inhibitor
  • Neuroendocrine-specific protein C homolog
  • Neuroendocrine-specific protein
  • NI220/250
  • Nogo protein
  • NOGO-A
  • Nogo-B
  • NOGOC
  • Nogo-C
  • NOGORTN4-B1
  • NSP
  • NSP-CL
  • reticulon 4
  • reticulon 5
  • reticulon-4
  • reticulon-5
  • RTN4-A
  • RTN4-B2
  • RTN4-C
  • RTN-x

Background

Nogo belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. Nogo is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1674
Species: Mu
Applications: WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-97677
Species: Hu, Mu, Rt, Po, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
MAB4077
Species: Hu
Applications: WB, IHC
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
MAB6967
Species: Hu
Applications: WB
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-69286
Species: Hu
Applications: WB

Publications for Nogo Antibody (NBP1-69286) (0)

There are no publications for Nogo Antibody (NBP1-69286).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nogo Antibody (NBP1-69286) (0)

There are no reviews for Nogo Antibody (NBP1-69286). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nogo Antibody (NBP1-69286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nogo Products

Bioinformatics Tool for Nogo Antibody (NBP1-69286)

Discover related pathways, diseases and genes to Nogo Antibody (NBP1-69286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nogo Antibody (NBP1-69286)

Discover more about diseases related to Nogo Antibody (NBP1-69286).
 

Pathways for Nogo Antibody (NBP1-69286)

View related products by pathway.

PTMs for Nogo Antibody (NBP1-69286)

Learn more about PTMs related to Nogo Antibody (NBP1-69286).
 

Research Areas for Nogo Antibody (NBP1-69286)

Find related products by research area.

Blogs on Nogo.

Nogo: A Promising Target for New Gene Therapies
Nogo is a neurite outgrowth inhibitor protein that plays an important role during central nervous system (CNS) development as well as in endoplasmic reticulum signaling regulation. Studies using Nogo antibodies have revealed Nogo proteins regulate...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nogo Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RTN4
Uniprot