Nodal Antibody (5C3) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Nodal Primary Antibodies

Order Details


    • Catalog Number
      H00004838-M03V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nodal Antibody (5C3) [DyLight 405] Summary

Immunogen
NODAL (NP_060525 275 a.a. - 346 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
Localization
Secreted
Specificity
NODAL - nodal homolog (mouse)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NODAL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 405
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nodal Antibody (5C3) [DyLight 405]

  • BMP-16
  • MGC138230
  • nodal homolog (mouse)
  • nodal homolog
  • Nodal
  • nodal, mouse, homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56479
Species: Hu, Mu, Rt, Po, Bv, Ca, Pm
Applications: WB, IHC-P
AF222
Species: Hu
Applications: WB, Block
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF746
Species: Hu, Mu
Applications: WB
MAB994
Species: Mu
Applications: WB
AF4248
Species: Hu
Applications: WB, ICC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
MAB5771
Species: Rt
Applications: WB, Flow, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP

Publications for Nodal Antibody (H00004838-M03V) (0)

There are no publications for Nodal Antibody (H00004838-M03V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nodal Antibody (H00004838-M03V) (0)

There are no reviews for Nodal Antibody (H00004838-M03V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nodal Antibody (H00004838-M03V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nodal Antibody (5C3) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for Nodal Antibody (H00004838-M03V)

Discover related pathways, diseases and genes to Nodal Antibody (H00004838-M03V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nodal Antibody (H00004838-M03V)

Discover more about diseases related to Nodal Antibody (H00004838-M03V).
 

Pathways for Nodal Antibody (H00004838-M03V)

View related products by pathway.

PTMs for Nodal Antibody (H00004838-M03V)

Learn more about PTMs related to Nodal Antibody (H00004838-M03V).
 

Research Areas for Nodal Antibody (H00004838-M03V)

Find related products by research area.

Blogs on Nodal

There are no specific blogs for Nodal, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Nodal Antibody (5C3) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol NODAL
Entrez
Uniprot