Nodal Antibody (5C3) [DyLight 488]



Product Details

Product Discontinued
View other related Nodal Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nodal Antibody (5C3) [DyLight 488] Summary

NODAL (NP_060525 275 a.a. - 346 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
NODAL - nodal homolog (mouse)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
IgG purified


Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nodal Antibody (5C3) [DyLight 488]

  • BMP-16
  • MGC138230
  • nodal homolog (mouse)
  • nodal homolog
  • Nodal
  • nodal, mouse, homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
Species: Hu
Applications: WB, Block
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: WB
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Rt
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for Nodal Antibody (H00004838-M03G) (0)

There are no publications for Nodal Antibody (H00004838-M03G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nodal Antibody (H00004838-M03G) (0)

There are no reviews for Nodal Antibody (H00004838-M03G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nodal Antibody (H00004838-M03G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Nodal Products

Bioinformatics Tool for Nodal Antibody (H00004838-M03G)

Discover related pathways, diseases and genes to Nodal Antibody (H00004838-M03G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nodal Antibody (H00004838-M03G)

Discover more about diseases related to Nodal Antibody (H00004838-M03G).

Pathways for Nodal Antibody (H00004838-M03G)

View related products by pathway.

PTMs for Nodal Antibody (H00004838-M03G)

Learn more about PTMs related to Nodal Antibody (H00004838-M03G).

Research Areas for Nodal Antibody (H00004838-M03G)

Find related products by research area.

Blogs on Nodal

There are no specific blogs for Nodal, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Nodal Antibody (5C3) [DyLight 488] and receive a gift card or discount.


Gene Symbol NODAL