Nodal Antibody (3B9)

Images

 

Product Details

Summary
Product Discontinued
View other related Nodal Primary Antibodies

Order Details


    • Catalog Number
      H00004838-M07
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nodal Antibody (3B9) Summary

Immunogen
NODAL (NP_060525, 180 a.a. - 279 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CWPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGE
Specificity
NODAL (3B9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NODAL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nodal Antibody (3B9)

  • BMP-16
  • MGC138230
  • nodal homolog (mouse)
  • nodal homolog
  • Nodal
  • nodal, mouse, homolog

Background

The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF1477
Species: Mu
Applications: WB, IHC, Block
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF746
Species: Hu, Mu
Applications: WB
MAB994
Species: Mu
Applications: WB
AF4248
Species: Hu
Applications: WB, ICC
423-F8/CF
Species: Hu, Mu
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
MAB5771
Species: Rt
Applications: WB, Flow, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP

Publications for Nodal Antibody (H00004838-M07) (0)

There are no publications for Nodal Antibody (H00004838-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nodal Antibody (H00004838-M07) (0)

There are no reviews for Nodal Antibody (H00004838-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nodal Antibody (H00004838-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nodal Products

Bioinformatics Tool for Nodal Antibody (H00004838-M07)

Discover related pathways, diseases and genes to Nodal Antibody (H00004838-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nodal Antibody (H00004838-M07)

Discover more about diseases related to Nodal Antibody (H00004838-M07).
 

Pathways for Nodal Antibody (H00004838-M07)

View related products by pathway.

PTMs for Nodal Antibody (H00004838-M07)

Learn more about PTMs related to Nodal Antibody (H00004838-M07).
 

Research Areas for Nodal Antibody (H00004838-M07)

Find related products by research area.

Blogs on Nodal

There are no specific blogs for Nodal, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nodal Antibody (3B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NODAL
Entrez
OMIM
Uniprot