NM23-H2/NME2 Antibody (4A7)

Images

 
Western Blot: NM23-H2/NME2 Antibody (4A7) [H00004831-M12] - Analysis of NME2 expression in transfected 293T cell line by NME2 monoclonal antibody (M12), clone 4A7. Lane 1: NME2 transfected lysatE (17.298 KDa). Lane 2: ...read more
Sandwich ELISA: NM23-H2/NME2 Antibody (4A7) [H00004831-M12] - Detection limit for recombinant GST tagged NME2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related NM23-H2/NME2 Primary Antibodies

Order Details


    • Catalog Number
      H00004831-M12
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NM23-H2/NME2 Antibody (4A7) Summary

Immunogen
NME2 (AAH02476, 1 a.a. - 152 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Specificity
non-metastatic cells 2, protein (NM23B) expressed in
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NME2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NM23-H2/NME2 Antibody (4A7)

  • EC 2.7.13.3
  • Histidine protein kinase NDKB
  • MGC2212
  • NDK B
  • NDKB
  • NDP Kinase B2
  • NDPKB
  • NDPK-B
  • NM23B
  • NM23-H2
  • NME2
  • non-metastatic cells 2, protein (NM23B) expressed in
  • nucleoside diphosphate kinase B
  • protein (NM23) expressed in

Background

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF3014
Species: Hu
Applications: WB, IHC, Block
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-02487
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33694
Species: Hu
Applications: IHC, IHC-P
NB100-387
Species: Hu, Mu, Rt
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-56908
Species: Hu
Applications: ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-259
Species: Hu, Mu
Applications: WB, GS, IP
H00004831-M12
Species: Hu
Applications: WB, ELISA

Publications for NM23-H2/NME2 Antibody (H00004831-M12) (0)

There are no publications for NM23-H2/NME2 Antibody (H00004831-M12).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NM23-H2/NME2 Antibody (H00004831-M12) (0)

There are no reviews for NM23-H2/NME2 Antibody (H00004831-M12). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NM23-H2/NME2 Antibody (H00004831-M12) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NM23-H2/NME2 Products

Bioinformatics Tool for NM23-H2/NME2 Antibody (H00004831-M12)

Discover related pathways, diseases and genes to NM23-H2/NME2 Antibody (H00004831-M12). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NM23-H2/NME2 Antibody (H00004831-M12)

Discover more about diseases related to NM23-H2/NME2 Antibody (H00004831-M12).
 

Pathways for NM23-H2/NME2 Antibody (H00004831-M12)

View related products by pathway.

PTMs for NM23-H2/NME2 Antibody (H00004831-M12)

Learn more about PTMs related to NM23-H2/NME2 Antibody (H00004831-M12).
 

Research Areas for NM23-H2/NME2 Antibody (H00004831-M12)

Find related products by research area.

Blogs on NM23-H2/NME2

There are no specific blogs for NM23-H2/NME2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NM23-H2/NME2 Antibody (4A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NME2
Entrez
OMIM
Uniprot