NLRP2/NALP2 Antibody


Western Blot: NALP2 Antibody [NBP1-68975] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related NLRP2/NALP2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NLRP2/NALP2 Antibody Summary

Synthetic peptides corresponding to NLRP2 (NLR family, pyrin domain containing 2) The peptide sequence was selected from the C terminal of NLRP2. Peptide sequence FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NLRP2 and was validated on Western blot.
Theoretical MW
120 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NLRP2/NALP2 Antibody

  • CLR19.9
  • FLJ20510
  • NACHT, leucine rich repeat and PYD containing 2
  • NACHT, LRR and PYD domains-containing protein 2
  • NALP2
  • NALP2NACHT, LRR and PYD containing protein 2
  • NBS1
  • NBS1PYRIN-containing APAF1-like protein 2
  • NLR family, pyrin domain containing 2
  • NLRP2
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 2
  • PAN1
  • PAN1Nucleotide-binding site protein 1
  • PYPAF2
  • PYPAF2PYRIN domain and NACHT domain-containing protein 1


NALP proteins, such as NALP2, are characterized by an N-terminal pyrin (MIM 608107) domain (PYD) and are involved in the activation of caspase-1 (CASP1; MIM 147678) by Toll-like receptors (see TLR4; MIM 603030). They may also be involved in protein complexes that activate proinflammatory caspases (Tschopp et al., 2003 [PubMed 12563287]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Mu
Applications: WB, IHC, Neut
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, KO
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, IP, PLA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
Species: Hu
Applications: WB, IHC

Publications for NLRP2/NALP2 Antibody (NBP1-68975) (0)

There are no publications for NLRP2/NALP2 Antibody (NBP1-68975).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP2/NALP2 Antibody (NBP1-68975) (0)

There are no reviews for NLRP2/NALP2 Antibody (NBP1-68975). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NLRP2/NALP2 Antibody (NBP1-68975) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NLRP2/NALP2 Products

Bioinformatics Tool for NLRP2/NALP2 Antibody (NBP1-68975)

Discover related pathways, diseases and genes to NLRP2/NALP2 Antibody (NBP1-68975). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP2/NALP2 Antibody (NBP1-68975)

Discover more about diseases related to NLRP2/NALP2 Antibody (NBP1-68975).

Pathways for NLRP2/NALP2 Antibody (NBP1-68975)

View related products by pathway.

PTMs for NLRP2/NALP2 Antibody (NBP1-68975)

Learn more about PTMs related to NLRP2/NALP2 Antibody (NBP1-68975).

Research Areas for NLRP2/NALP2 Antibody (NBP1-68975)

Find related products by research area.

Blogs on NLRP2/NALP2

There are no specific blogs for NLRP2/NALP2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NLRP2/NALP2 Antibody and receive a gift card or discount.


Gene Symbol NLRP2