NKX3.1 Antibody (3H6)

Images

 
Western Blot: NKX3.1 Antibody (3H6) [H00004824-M01] - NKX3-1 monoclonal antibody (M01), clone 3H6. Analysis of NKX3-1 expression in human colon.
Sandwich ELISA: NKX3.1 Antibody (3H6) [H00004824-M01] - Detection limit for recombinant GST tagged NKX3-1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NKX3.1 Antibody (3H6) Summary

Immunogen
NKX3-1 (NP_006158, 100 a.a. - 209 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS
Specificity
NKX3-1 (3H6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NKX3-1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NKX3.1 Antibody (3H6)

  • BAPX2
  • BAPX2homeobox protein Nkx-3.1
  • Homeobox protein NK-3 homolog A
  • NK homeobox (Drosophila), family 3, A
  • NK3 homeobox 1
  • NK3 transcription factor homolog A
  • NK3 transcription factor related, locus 1 (Drosophila)
  • NK3 transcription factor related, locus 1
  • NKX3.1
  • NKX3.1NKX3
  • NKX3-1
  • NKX3A
  • NKX3ANK homeobox, family 3, A

Background

The homeodomain-containing transcription factor NKX3A is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3A protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1555
Species: Hu
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NKX3.1 Antibody (H00004824-M01) (0)

There are no publications for NKX3.1 Antibody (H00004824-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX3.1 Antibody (H00004824-M01) (0)

There are no reviews for NKX3.1 Antibody (H00004824-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKX3.1 Antibody (H00004824-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKX3.1 Products

Bioinformatics Tool for NKX3.1 Antibody (H00004824-M01)

Discover related pathways, diseases and genes to NKX3.1 Antibody (H00004824-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKX3.1 Antibody (H00004824-M01)

Discover more about diseases related to NKX3.1 Antibody (H00004824-M01).
 

Pathways for NKX3.1 Antibody (H00004824-M01)

View related products by pathway.

PTMs for NKX3.1 Antibody (H00004824-M01)

Learn more about PTMs related to NKX3.1 Antibody (H00004824-M01).
 

Research Areas for NKX3.1 Antibody (H00004824-M01)

Find related products by research area.

Blogs on NKX3.1

There are no specific blogs for NKX3.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKX3.1 Antibody (3H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX3-1
Entrez
OMIM
Uniprot