NKX2.5 Antibody (3E3.)

Images

 
Western Blot: NKX2.5 Antibody (3E3) [H00001482-M08] - Analysis of NKX2-5 expression in transfected 293T cell line by NKX2-5 monoclonal antibody (M08), clone 3E3. Lane 1: NKX2-5 transfected lysatE (34.92 KDa). Lane 2: ...read more

Product Details

Summary
Product Discontinued
View other related NKX2.5 Primary Antibodies

Order Details


    • Catalog Number
      H00001482-M08
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NKX2.5 Antibody (3E3.) Summary

Immunogen
NKX2-5 (NP_004378, 1 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA*
Marker
Cardiac Progenitor Marker
Specificity
NKX2-5 - NK2 transcription factor related, locus 5 (Drosophila) (3E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NKX2-5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NKX2.5 Antibody (3E3.)

  • cardiac-specific homeo box
  • cardiac-specific homeobox 1
  • Cardiac-specific homeobox
  • CHNG5
  • CSX1
  • CSXFLJ97195
  • FLJ52202
  • FLJ99536
  • Homeobox protein CSX
  • Homeobox protein NK-2 homolog E
  • homeobox protein Nkx-2.5
  • NK2 transcription factor related, locus 5 (Drosophila)
  • NKX2.5
  • NKX2.5FLJ97166
  • NKX2-5
  • NKX2E
  • NKX2EFLJ97197
  • NKX4-1
  • tinman paralog

Background

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
H00001482-M08
Species: Hu
Applications: WB, ELISA

Publications for NKX2.5 Antibody (H00001482-M08) (0)

There are no publications for NKX2.5 Antibody (H00001482-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX2.5 Antibody (H00001482-M08) (0)

There are no reviews for NKX2.5 Antibody (H00001482-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKX2.5 Antibody (H00001482-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKX2.5 Products

Bioinformatics Tool for NKX2.5 Antibody (H00001482-M08)

Discover related pathways, diseases and genes to NKX2.5 Antibody (H00001482-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKX2.5 Antibody (H00001482-M08)

Discover more about diseases related to NKX2.5 Antibody (H00001482-M08).
 

Pathways for NKX2.5 Antibody (H00001482-M08)

View related products by pathway.

PTMs for NKX2.5 Antibody (H00001482-M08)

Learn more about PTMs related to NKX2.5 Antibody (H00001482-M08).

Blogs on NKX2.5.

6 Fictional Character Protein Names
Check out our list of some of the funniest fictional character protein names including GOLM1, SMURF1, HOMER1, Hunchback, Lilliputian, Pokemon, Tinman Paralog, and Draculin. What are your favorite or funniest protein names? Share them in the comments;...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKX2.5 Antibody (3E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX2-5
Entrez
Uniprot