Recombinant Human NKp80/KLRF1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related NKp80/KLRF1 Peptides and Proteins

Order Details


    • Catalog Number
      H00051348-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human NKp80/KLRF1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 69-166 of Human KLRF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLR

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
KLRF1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NKp80/KLRF1 Protein

  • Activating coreceptor NKp80
  • CLEC5C
  • CLEC5CMGC119908
  • C-type lectin domain family 5 member C
  • killer cell lectin-like receptor F1
  • killer cell lectin-like receptor subfamily F member 1
  • killer cell lectin-like receptor subfamily F, member 1
  • KLRF1
  • Lectin-like receptor F1
  • MGC119907
  • MGC119909
  • ML
  • NKp80

Background

KLRF1 - killer cell lectin-like receptor subfamily F, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
AF2225
Species: Mu
Applications: WB, Flow, AgAct, CyTOF-ready
9059-CL
Species: Hu
1849-NK
Species: Hu
2249-NK
Species: Hu
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready
MAB2238
Species: Hu
Applications: Flow, AgAct, CyTOF-reported
AF1718
Species: Hu, Mu, Rt
Applications: WB
AF1039
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB19081
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
H00051348-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01) (0)

There are no publications for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01) (0)

There are no reviews for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKp80/KLRF1 Products

Bioinformatics Tool for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01)

Discover related pathways, diseases and genes to NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01)

Discover more about diseases related to NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01).
 

Pathways for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01)

View related products by pathway.

PTMs for NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01)

Learn more about PTMs related to NKp80/KLRF1 Partial Recombinant Protein (H00051348-Q01).

Blogs on NKp80/KLRF1

There are no specific blogs for NKp80/KLRF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NKp80/KLRF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KLRF1
Entrez