NK3R/TACR3/Neurokinin B Receptor Antibody


Western Blot: NK3R/TACR3/Neurokinin B Receptor Antibody [NBP1-98286] - Titration: 1.0 ug/ml Positive Control: NCI-H226 Whole Cell.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NK3R/TACR3/Neurokinin B Receptor Antibody Summary

The immunogen for this antibody is TACR3 - C-terminal region. Peptide sequence NDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NK3R/TACR3/Neurokinin B Receptor Antibody

  • Neurokinin B Receptor
  • neurokinin beta receptor
  • Neuromedin-K Receptor
  • NK-3 receptor
  • NK3R
  • NK-3R
  • NK3RMGC148061
  • NKR
  • TAC3R
  • TAC3RL
  • tachykinin receptor 3MGC148060
  • TACR3


This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin neurokinin 3, also referred to as neurokinin B.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Flow, Block, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Po, Bv, Gt
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, CyTOF-reported, Neut
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286) (0)

There are no publications for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286) (0)

There are no reviews for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286)

Discover related pathways, diseases and genes to NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286)

Discover more about diseases related to NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286).

Pathways for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286)

View related products by pathway.

Blogs on NK3R/TACR3/Neurokinin B Receptor

There are no specific blogs for NK3R/TACR3/Neurokinin B Receptor, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NK3R/TACR3/Neurokinin B Receptor Antibody and receive a gift card or discount.


Gene Symbol TACR3