NK3R/TACR3/Neurokinin B Receptor Antibody

Images

 
Western Blot: NK3R/TACR3/Neurokinin B Receptor Antibody [NBP1-98286] - Titration: 1.0 ug/ml Positive Control: NCI-H226 Whole Cell.

Order Details


    • Catalog Number
      NBP1-98286
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NK3R/TACR3/Neurokinin B Receptor Antibody Summary

Immunogen
The immunogen for this antibody is TACR3 - C-terminal region. Peptide sequence NDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS.
Clonality
Polyclonal
Host
Rabbit
Gene
TACR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NK3R/TACR3/Neurokinin B Receptor Antibody

  • Neurokinin B Receptor
  • neurokinin beta receptor
  • Neuromedin-K Receptor
  • NK-3 receptor
  • NK-3R
  • NK3R/TACR3
  • NK3RMGC148061
  • NKR
  • TAC3R
  • TAC3RL
  • tachykinin receptor 3MGC148060
  • TACR3

Background

This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin neurokinin 3, also referred to as neurokinin B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1058
Species: Hu
Applications: Flow, Block
NBP2-35058
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NLS1926
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Ha, Mk, Pm
Applications: IHC-P
NBP2-41160
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
FAB1225A
Species: Hu
Applications: Flow
MAB20172
Species: Hu
Applications: WB, Neut
MAB139
Species: Hu
Applications: WB, Flow, CostimT, Neut
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP

Publications for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286) (0)

There are no publications for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286) (0)

There are no reviews for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NK3R/TACR3/Neurokinin B Receptor Products

Related Products by Gene

Bioinformatics Tool for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286)

Discover related pathways, diseases and genes to NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286)

Discover more about diseases related to NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286).
 

Pathways for NK3R/TACR3/Neurokinin B Receptor Antibody (NBP1-98286)

View related products by pathway.

Blogs on NK3R/TACR3/Neurokinin B Receptor

There are no specific blogs for NK3R/TACR3/Neurokinin B Receptor, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TACR3
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98286 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.