Recombinant Human NK1R Protein

Images

 
There are currently no images for NK1R Recombinant Protein (H00006869-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Func

Order Details

Recombinant Human NK1R Protein Summary

Description
An un-tagged recombinant protein corresponding to the amino acids 1-311 of Human TACR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TACR1

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NK1R Protein

  • NK1R
  • NK-1R
  • NK1Rneurokinin 1 receptor
  • NKIR
  • SPR
  • SPRsubstance-P receptor
  • TAC1R
  • TAC1Rtachykinin 1 receptor (substance P receptor, neurokinin 1 receptor)
  • tachykinin receptor 1 (substance P receptor; neurokinin-1 receptor)
  • tachykinin receptor 1NK-1 receptor
  • TACR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB4077
Species: Hu
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-102
Species: Mu, Rt, GP, Sh, Hu(-)
Applications: WB (-), ICC/IF, IHC, IHC-Fr, IHC-FrFl
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-12553
Species: Hu
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for NK1R Recombinant Protein (H00006869-G01) (0)

There are no publications for NK1R Recombinant Protein (H00006869-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NK1R Recombinant Protein (H00006869-G01) (0)

There are no reviews for NK1R Recombinant Protein (H00006869-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NK1R Recombinant Protein (H00006869-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NK1R Products

Bioinformatics Tool for NK1R Recombinant Protein (H00006869-G01)

Discover related pathways, diseases and genes to NK1R Recombinant Protein (H00006869-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NK1R Recombinant Protein (H00006869-G01)

Discover more about diseases related to NK1R Recombinant Protein (H00006869-G01).
 

Pathways for NK1R Recombinant Protein (H00006869-G01)

View related products by pathway.

PTMs for NK1R Recombinant Protein (H00006869-G01)

Learn more about PTMs related to NK1R Recombinant Protein (H00006869-G01).
 

Research Areas for NK1R Recombinant Protein (H00006869-G01)

Find related products by research area.

Blogs on NK1R

There are no specific blogs for NK1R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NK1R Antibody
NB300-119

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NK1R Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TACR1
Entrez