NIT2 Antibody

Images

 
Western Blot: NIT2 Antibody [NBP1-54638] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related NIT2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54638
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NIT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NIT2(nitrilase family, member 2) The peptide sequence was selected from the middle region of NIT2. Peptide sequence VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP.
Clonality
Polyclonal
Host
Rabbit
Gene
NIT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NIT2 and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NIT2 Antibody

  • EC 3.5.1.3
  • MGC111199
  • Nit protein 2
  • nitrilase family, member 2
  • Nitrilase homolog 2
  • omega-amidase NIT2

Background

NIT2 belongs to the UPF0012 family and contains 1 CN hydrolase domain. Overexpression of NIT2 decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02462
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF6144
Species: Hu
Applications: WB, Simple Western
H00055821-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56943
Species: Hu
Applications: ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for NIT2 Antibody (NBP1-54638) (0)

There are no publications for NIT2 Antibody (NBP1-54638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIT2 Antibody (NBP1-54638) (0)

There are no reviews for NIT2 Antibody (NBP1-54638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIT2 Antibody (NBP1-54638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIT2 Products

Bioinformatics Tool for NIT2 Antibody (NBP1-54638)

Discover related pathways, diseases and genes to NIT2 Antibody (NBP1-54638). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIT2 Antibody (NBP1-54638)

Discover more about diseases related to NIT2 Antibody (NBP1-54638).
 

Pathways for NIT2 Antibody (NBP1-54638)

View related products by pathway.

PTMs for NIT2 Antibody (NBP1-54638)

Learn more about PTMs related to NIT2 Antibody (NBP1-54638).
 

Research Areas for NIT2 Antibody (NBP1-54638)

Find related products by research area.

Blogs on NIT2

There are no specific blogs for NIT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NIT2
Uniprot