NISCH Antibody

Images

 
Western Blot: NISCH Antibody [NBP2-87919] - Host: Rabbit. Target Name: NISCH. Sample Tissue: Human PANC1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NISCH Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human NISCH. Peptide sequence: LLDEDCVHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMGYQTYPQALT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NISCH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NISCH Antibody

  • hIRAS
  • I-1 receptor candidate protein
  • I-1FLJ14425
  • I1R candidate protein
  • I1R
  • Imidazoline receptor 1
  • imidazoline receptor antisera selected
  • Imidazoline receptor antisera-selected protein
  • imidazoline receptor candidate
  • Imidazoline-1 receptor candidate protein
  • Imidazoline-1 receptor
  • IR1
  • IRASFLJ40413
  • KIAA0975FLJ90519
  • nischarin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67695
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-19807
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47842
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP1-76996
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NB300-234
Species: Hu, Mu, Rt
Applications: WB
NBP1-87581
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-87919
Species: Hu
Applications: WB

Publications for NISCH Antibody (NBP2-87919) (0)

There are no publications for NISCH Antibody (NBP2-87919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NISCH Antibody (NBP2-87919) (0)

There are no reviews for NISCH Antibody (NBP2-87919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NISCH Antibody (NBP2-87919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NISCH Products

Array NBP2-87919

Bioinformatics Tool for NISCH Antibody (NBP2-87919)

Discover related pathways, diseases and genes to NISCH Antibody (NBP2-87919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NISCH Antibody (NBP2-87919)

Discover more about diseases related to NISCH Antibody (NBP2-87919).
 

Pathways for NISCH Antibody (NBP2-87919)

View related products by pathway.

PTMs for NISCH Antibody (NBP2-87919)

Learn more about PTMs related to NISCH Antibody (NBP2-87919).
 

Research Areas for NISCH Antibody (NBP2-87919)

Find related products by research area.

Blogs on NISCH

There are no specific blogs for NISCH, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NISCH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NISCH