Home » NISCH » NISCH Antibodies » NISCH Antibody

NISCH Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NISCH Antibody [NBP2-87919] - Host: Rabbit. Target Name: NISCH. Sample Tissue: Human PANC1 Whole Cell lysates. Antibody Dilution: 1ug/ml
Western Blot: NISCH Antibody [NBP2-87919] - Host: Rabbit. Target Name: NISCH. Sample Tissue: Human PANC1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NISCH Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human NISCH. Peptide sequence: LLDEDCVHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMGYQTYPQALT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NISCH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NISCH Antibody

  • hIRAS
  • I-1 receptor candidate protein
  • I-1FLJ14425
  • I1R candidate protein
  • I1R
  • Imidazoline receptor 1
  • imidazoline receptor antisera selected
  • Imidazoline receptor antisera-selected protein
  • imidazoline receptor candidate
  • Imidazoline-1 receptor candidate protein
  • Imidazoline-1 receptor
  • IR1
  • IRASFLJ40413
  • KIAA0975FLJ90519
  • nischarin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Protein
Phosphatase inhibitor ...
NBP2-67695
Western Blot: Protein Phosphatase inhibitor 1 Antibody (SN0756) [NBP2-67695] - Analysis of PPP1R1A on Rat brain lysates using anti-PPP1R1A antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Protein Phosphatase inhibitor 1 Antibody (SN0756) [NBP2-67695] - Staining PPP1R1A in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Protein Phosphatase inhibitor 1 Antibody (SN0756) [NBP2-67695] - Analysis of paraffin-embedded mouse kidney tissue using anti-PPP1R1A antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Western Blot: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - A. 30 ug Neuro2A whole cell lysate/extract. B. 30 ug GL261 whole cell lysate/extract. C. 30 ug C8D30 whole cell lysate/extract. D. 30 ug NIH-3T3 whole cell lysate/extract. E. 30 ug BCL-1 whole cell lysate/extract. F. 30 ug Raw264.7 whole cell lysate/extract. G. 30 ug C2C12 whole cell lysate/extract.
Immunocytochemistry/Immunofluorescence: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Inorganic Pyrophosphatase/PPA1 Antibody [NBP1-31348] - Paraffin-embedded OVCAR3 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
FXR/NR1H4 Antibody
NB400-153
Western Blot: FXR/NR1H4 Antibody [NB400-153] - Total protein from human A549, U2OS cell and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-FXR (NB400-153) in block buffer and detected with an anti-rabbit HRP secondary antibody using NovaLume chemiluminescence detection reagent (NPB2-61915).
Immunocytochemistry/Immunofluorescence: FXR/NR1H4 Antibody [NB400-153] - A549 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-FXR/NR1H4 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: FXR Antibody [NB400-153] - Detection of FXR in HeLa nuclear extract using NB400-153. ECL 30 minute detection.
(3 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF
C-Reactive
Protein/CRP [HRP]
DCRP00
C-Reactive Protein/CRP [HRP]
(4 Reviews)
(83 Publications)
Species: Hu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin: Insulin Receptor beta Antibody [NBP2-12793] - Staining shows expression of insulin receptor beta in the Cortex in mouse brain. Dilution 1:500
Immunoprecipitation: Insulin Receptor beta Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Phospholamban
Antibody
NBP2-19807
Western Blot: Phospholamban Antibody [NBP2-19807] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Phospholamban antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Phospholamban Antibody [NBP2-19807] - Human colon carcinoma, using phospholamban antibody at 1:250 dilution.Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AKT1 [p Ser473]
Antibody (104A282)
NB100-56749
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - Total protein from mouse 3T3 cells treated with and without PDGF (50 ng/mL) for the indicated times was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-AKT1 (NBP2-01725) and 2 ug/mL pS473 AKT1 in 1% BSA in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Note the detection of phosphorylated AKT1 in response to PDGF treatment compared to total AKT1 protein.
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - WB of phospho AKT using phospho AKT antibody at 2 ug/mL against untreated (lane 1) and PDGF treated (lane 2) NIH-3T3 lysate. HRP conjugated secondary antibody and ECL substrate solution were used for this test. Image using the Azide and BSA Free form of this antibody.
Immunohistochemistry-Paraffin: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - IHC analysis of an FFPE human breast carcinoma tissue section using 1:250 dilution of phospho Ser473 AKT1 antibody (clone 104A282) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10 mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of phosphor-AKT (Ser-473) in the cancer cells as well as the stromal cells. Staining was performed by Histowiz.
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
Serpin E1/PAI-1
Antibody
NBP1-19773
Western Blot: Serpin E1/PAI-1 Antibody [NBP1-19773] - Extracts from Jurkat cells.
Immunohistochemistry-Paraffin: Serpin E1/PAI-1 Antibody [NBP1-19773] - Staining of PAI1/Serpine 1 in mouse pancreas.
Western Blot: Serpin E1/PAI-1 Antibody [NBP1-19773] - Immunoblots showing protein expression of ALK5, pSMAD2/3, PAI-1, pVHL, andI2-actin in A498 cells after treatment with TGF-i2 at given point of time. Image collected and cropped by Cite Ab from the following publication (VHL status regulates transforming growth factor B signaling pathways in renal cell carcinoma. Oncotarget (2018)) licensed under a CC-BY licence.
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(39 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
ERK2 Antibody
(OTI6E5)
NBP1-47842
Western Blot: ERK2 Antibody (6E5) [NBP1-47842] - Analysis of extracts (35ug) from 9 different cell lines by using anti-ERK2 monoclonal antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Western Blot: ERK2 Antibody (6E5) [NBP1-47842] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ERK2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ERK2.
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
CDIP Antibody
NBP1-76996
Western Blot: CDIP Antibody [NBP1-76996] - Human brain lysate with CDIP antibody at (A) 0.25 and (B) 0.5 ug/ml.
Immunocytochemistry/Immunofluorescence: CDIP Antibody [NBP1-76996] - Immunofluorescence of CDIP1 in mouse brain tissue with CDIP1 antibody at 20 ug/mL.
Immunohistochemistry-Paraffin: CDIP Antibody [NBP1-76996] - Mouse brain tissue with CDIP antibody at 2.5 ug/mL.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(154 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
DARPP-32 [p Thr75]
Antibody
NB300-234
Western Blot: DARPP32 [p Thr75] Antibody [NB300-234] - Analysis of rat caudate lysate showing specific immunolabeling of the ~32k DARPP-32 phosphorylated at Thr75 (Control). The phosphospecificity of this labeling is shown in the second lane (lambda-phosphatase). The blot is identical to the control except that it was incubated (1200 units for 30 min) before being exposed to the Anti-Thr75 DARPP-32. The immunolabeling is completely eliminated by treatment.
Western Blot: DARPP32 [p Thr75] Antibody [NB300-234] - Analysis of Rat caudate lysates prepared from caudate slices that had been incubated in the absence and presence of okadaic acid. The labeling by the antibody to DARPP-32 Thr75 is markedly increased by the okadaic acid treatment.
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Analysis in human small intestine and stomach tissues. Corresponding SI RNA-seq data are presented for the same tissues.
Western Blot: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human stomach shows no positivity in glandular cells as expected.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
PMEL17/SILV
Antibody
NBP1-69571
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NISCH Antibody
NBP2-87919
NISCH Antibody
Species: Hu
Applications: WB

Publications for NISCH Antibody (NBP2-87919) (0)

There are no publications for NISCH Antibody (NBP2-87919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NISCH Antibody (NBP2-87919) (0)

There are no reviews for NISCH Antibody (NBP2-87919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NISCH Antibody (NBP2-87919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NISCH Products

Array NBP2-87919

Bioinformatics Tool for NISCH Antibody (NBP2-87919)

Discover related pathways, diseases and genes to NISCH Antibody (NBP2-87919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NISCH Antibody (NBP2-87919)

Discover more about diseases related to NISCH Antibody (NBP2-87919).
 

Pathways for NISCH Antibody (NBP2-87919)

View related products by pathway.

PTMs for NISCH Antibody (NBP2-87919)

Learn more about PTMs related to NISCH Antibody (NBP2-87919).
 

Research Areas for NISCH Antibody (NBP2-87919)

Find related products by research area.

Blogs on NISCH

There are no specific blogs for NISCH, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NISCH Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NISCH