NIPP1 Antibody

Images

 
Western Blot: NIPP1 Antibody [NBP1-57263] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related NIPP1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57263
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NIPP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PPP1R8(protein phosphatase 1, regulatory (inhibitor) subunit 8) The peptide sequence was selected from the N terminal of PPP1R8. Peptide sequence DKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PPP1R8 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NIPP1 Antibody

  • activator of RNA decay
  • ARD1
  • ard-1
  • ARD1nuclear inhibitor of protein phosphatase 1
  • NIPP1
  • NIPP1nuclear inhibitor of protein phosphatase-1
  • NIPP-1nuclear subunit of PP-1
  • PPP1R8
  • PRO2047
  • Protein phosphatase 1 regulatory inhibitor subunit 8
  • protein phosphatase 1 regulatory subunit 8
  • protein phosphatase 1, regulatory (inhibitor) subunit 8
  • RNase E

Background

This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67695
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-03349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
NBP2-33934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-65899
Species: Hu
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-24643
Species: Mu, Rt
Applications: WB
NBP1-86794
Species: Hu
Applications: WB, ICC/IF
NBP2-65749
Species: Hu

Publications for NIPP1 Antibody (NBP1-57263) (0)

There are no publications for NIPP1 Antibody (NBP1-57263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIPP1 Antibody (NBP1-57263) (0)

There are no reviews for NIPP1 Antibody (NBP1-57263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIPP1 Antibody (NBP1-57263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NIPP1 Products

Bioinformatics Tool for NIPP1 Antibody (NBP1-57263)

Discover related pathways, diseases and genes to NIPP1 Antibody (NBP1-57263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIPP1 Antibody (NBP1-57263)

Discover more about diseases related to NIPP1 Antibody (NBP1-57263).
 

Pathways for NIPP1 Antibody (NBP1-57263)

View related products by pathway.

PTMs for NIPP1 Antibody (NBP1-57263)

Learn more about PTMs related to NIPP1 Antibody (NBP1-57263).

Blogs on NIPP1

There are no specific blogs for NIPP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIPP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R8
Uniprot