NIFK Antibody


Western Blot: NIFK Antibody [NBP1-57149] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related NIFK Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NIFK Antibody Summary

Synthetic peptides corresponding to MKI67IP(MKI67 (FHA domain) interacting nucleolar phosphoprotein) The peptide sequence was selected from the middle region of MKI67IP. Peptide sequence QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MKI67IP and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NIFK Antibody

  • hNIFK
  • MKI67 (FHA domain) interacting nucleolar phosphoprotein
  • MKI67 FHA domain-interacting nucleolar phosphoprotein
  • Nopp34
  • Nucleolar phosphoprotein Nopp34
  • Nucleolar protein interacting with the FHA domain of pKI-67


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Rb, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, CyTOF-ready
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for NIFK Antibody (NBP1-57149) (0)

There are no publications for NIFK Antibody (NBP1-57149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIFK Antibody (NBP1-57149) (0)

There are no reviews for NIFK Antibody (NBP1-57149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIFK Antibody (NBP1-57149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NIFK Products

Bioinformatics Tool for NIFK Antibody (NBP1-57149)

Discover related pathways, diseases and genes to NIFK Antibody (NBP1-57149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIFK Antibody (NBP1-57149)

Discover more about diseases related to NIFK Antibody (NBP1-57149).

Pathways for NIFK Antibody (NBP1-57149)

View related products by pathway.

PTMs for NIFK Antibody (NBP1-57149)

Learn more about PTMs related to NIFK Antibody (NBP1-57149).

Research Areas for NIFK Antibody (NBP1-57149)

Find related products by research area.

Blogs on NIFK

There are no specific blogs for NIFK, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NIFK Antibody and receive a gift card or discount.


Gene Symbol MKI67IP