NIFK Antibody

Images

 
Western Blot: NIFK Antibody [NBP1-57149] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related NIFK Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57149
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NIFK Antibody Summary

Immunogen
Synthetic peptides corresponding to MKI67IP(MKI67 (FHA domain) interacting nucleolar phosphoprotein) The peptide sequence was selected from the middle region of MKI67IP. Peptide sequence QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI.
Clonality
Polyclonal
Host
Rabbit
Gene
MKI67IP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MKI67IP and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NIFK Antibody

  • hNIFK
  • MKI67 (FHA domain) interacting nucleolar phosphoprotein
  • MKI67 FHA domain-interacting nucleolar phosphoprotein
  • NIFKNOPP34
  • Nopp34
  • Nucleolar phosphoprotein Nopp34
  • Nucleolar protein interacting with the FHA domain of pKI-67

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83252
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-170
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57149
Species: Hu
Applications: WB

Publications for NIFK Antibody (NBP1-57149) (0)

There are no publications for NIFK Antibody (NBP1-57149).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIFK Antibody (NBP1-57149) (0)

There are no reviews for NIFK Antibody (NBP1-57149). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIFK Antibody (NBP1-57149) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIFK Products

Bioinformatics Tool for NIFK Antibody (NBP1-57149)

Discover related pathways, diseases and genes to NIFK Antibody (NBP1-57149). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIFK Antibody (NBP1-57149)

Discover more about diseases related to NIFK Antibody (NBP1-57149).
 

Pathways for NIFK Antibody (NBP1-57149)

View related products by pathway.

PTMs for NIFK Antibody (NBP1-57149)

Learn more about PTMs related to NIFK Antibody (NBP1-57149).
 

Research Areas for NIFK Antibody (NBP1-57149)

Find related products by research area.

Blogs on NIFK

There are no specific blogs for NIFK, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIFK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKI67IP