Recombinant Human Nidogen-2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Nidogen-2 Peptides and Proteins

Order Details


    • Catalog Number
      H00022795-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Nidogen-2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1276-1375 of Human NID2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
NID2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl, pH 7.2, 1 mM EDTA, 50% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nidogen-2 Protein

  • NID2
  • NID-2
  • nidogen 2 (osteonidogen)
  • Nidogen2
  • Nidogen-2
  • Osteonidogen

Background

Basement membranes, which are composed of type IV collagens (see MIM 120130), laminins (see LAMC1; MIM 150290), perlecan (HSPG2; MIM 142461), and nidogen (see NID1; MIM 131390), are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2570
Species: Hu
Applications: WB, IHC
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
AF2075
Species: Hu
Applications: WB, IHC, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Nidogen-2 Partial Recombinant Protein (H00022795-Q01) (0)

There are no publications for Nidogen-2 Partial Recombinant Protein (H00022795-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nidogen-2 Partial Recombinant Protein (H00022795-Q01) (0)

There are no reviews for Nidogen-2 Partial Recombinant Protein (H00022795-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nidogen-2 Partial Recombinant Protein (H00022795-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nidogen-2 Products

Bioinformatics Tool for Nidogen-2 Partial Recombinant Protein (H00022795-Q01)

Discover related pathways, diseases and genes to Nidogen-2 Partial Recombinant Protein (H00022795-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nidogen-2 Partial Recombinant Protein (H00022795-Q01)

Discover more about diseases related to Nidogen-2 Partial Recombinant Protein (H00022795-Q01).
 

Pathways for Nidogen-2 Partial Recombinant Protein (H00022795-Q01)

View related products by pathway.

PTMs for Nidogen-2 Partial Recombinant Protein (H00022795-Q01)

Learn more about PTMs related to Nidogen-2 Partial Recombinant Protein (H00022795-Q01).

Blogs on Nidogen-2

There are no specific blogs for Nidogen-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nidogen-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NID2
Entrez