Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen

Images

 
There are currently no images for Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen (NBP2-49128PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nicotinic Acetylcholine R alpha 5/CHRNA5.

Source: E. coli

Amino Acid Sequence: AQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHRNA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49128.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen

  • Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5
  • cholinergic receptor, nicotinic, alpha 5
  • cholinergic receptor, nicotinic, alpha polypeptide 5
  • CHRNA5
  • LNCR2
  • NACHRA5
  • neuronal acetylcholine receptor subunit alpha-5
  • neuronal nicotinic acetylcholine receptor, alpha5 subunit
  • Nicotinic Acetylcholine R alpha 5
  • Nicotinic Acetylcholine Ra5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61673
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-61743
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-61674
Species: Hu
Applications: ELISA, WB
NBP1-28467
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00009455-B01P
Species: Hu, Mu, Rt
Applications: WB
H00001142-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01437
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-1798
Species: Hu, Mu
Applications: GS, GS, ICC/IF, IHC, IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-52375
Species: Bv, Ca, Ch, Eq, Hu, Pm, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-38474
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP2-61667
Species: Hu, Rt
Applications: ELISA, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP2-61679
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01608
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
H00001134-Q01
Species: Hu
Applications: ELISA, Flow, AP, PA, PAGE, WB
NBP2-49128PEP
Species: Hu
Applications: AC

Publications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen (NBP2-49128PEP) (0)

There are no publications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen (NBP2-49128PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen (NBP2-49128PEP) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen (NBP2-49128PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen (NBP2-49128PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Additional Nicotinic Acetylcholine R alpha 5/CHRNA5 Products

Research Areas for Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen (NBP2-49128PEP)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 5/CHRNA5

There are no specific blogs for Nicotinic Acetylcholine R alpha 5/CHRNA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 5/CHRNA5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA5