NHLH2 Antibody (3E3.)

Images

 
Sandwich ELISA: NHLH2 Antibody (3E3) [H00004808-M06] - Detection limit for recombinant GST tagged NHLH2 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related NHLH2 Primary Antibodies

Order Details


    • Catalog Number
      H00004808-M06
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NHLH2 Antibody (3E3.) Summary

Immunogen
NHLH2 (NP_005590, 36 a.a. - 135 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATR ERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Specificity
NHLH2 - nescient helix loop helix 2 (3E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NHLH2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NHLH2 Antibody (3E3.)

  • BHLHA34
  • bHLHa34NSCL-2
  • Class A basic helix-loop-helix protein 34
  • helix-loop-helix protein 2
  • HEN-2
  • HEN2NSCL2
  • nescient helix loop helix 2KIAA0490

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004807-T01
Species: Hu
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-06797
Species: Hu
AF2746
Species: Hu, Mu
Applications: WB, ICC
AF2567
Species: Mu
Applications: WB, IHC
NBP2-33443
Species: Hu
Applications: IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-32620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-78626
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00055885-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-31318
Species: Mu
Applications: IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
H00004808-M06
Species: Hu
Applications: ELISA

Publications for NHLH2 Antibody (H00004808-M06) (0)

There are no publications for NHLH2 Antibody (H00004808-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHLH2 Antibody (H00004808-M06) (0)

There are no reviews for NHLH2 Antibody (H00004808-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NHLH2 Antibody (H00004808-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHLH2 Products

Bioinformatics Tool for NHLH2 Antibody (H00004808-M06)

Discover related pathways, diseases and genes to NHLH2 Antibody (H00004808-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHLH2 Antibody (H00004808-M06)

Discover more about diseases related to NHLH2 Antibody (H00004808-M06).
 

Pathways for NHLH2 Antibody (H00004808-M06)

View related products by pathway.

PTMs for NHLH2 Antibody (H00004808-M06)

Learn more about PTMs related to NHLH2 Antibody (H00004808-M06).

Blogs on NHLH2

There are no specific blogs for NHLH2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHLH2 Antibody (3E3.) and receive a gift card or discount.

Bioinformatics

Gene Symbol NHLH2
Entrez
Uniprot