NHERF-2 Recombinant Protein Antigen

Images

 
There are currently no images for NHERF-2 Protein (NBP1-84944PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NHERF-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC9A3R2.

Source: E. coli

Amino Acid Sequence: RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC9A3R2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84944.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NHERF-2 Recombinant Protein Antigen

  • E3KARP
  • Na(+)/H(+) exchange regulatory cofactor NHE-RF2
  • NHE3RF2
  • NHERF2MGC104639
  • NHERF-2NHE3 kinase A regulatory protein E3KARP
  • OCTS2
  • SIP-1SRY-interacting protein 1
  • sodium/hydrogen exchanger
  • Sodium-hydrogen exchanger regulatory factor 2
  • solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulator 2
  • solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatoryfactor 2
  • solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2
  • Solute carrier family 9 isoform A3 regulatory factor 2
  • TKA-1SIP1
  • Tyrosine kinase activator protein 1

Background

NHERF-2 is a scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May also act as scaffold protein in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35065
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-82991
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-82574
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP1-05987
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
NBP2-16396
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB400-149
Species: Bv, Hu, Mu, Rt(-)
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00079833-B01P
Species: Hu
Applications: ICC/IF, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for NHERF-2 Protein (NBP1-84944PEP) (0)

There are no publications for NHERF-2 Protein (NBP1-84944PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHERF-2 Protein (NBP1-84944PEP) (0)

There are no reviews for NHERF-2 Protein (NBP1-84944PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NHERF-2 Protein (NBP1-84944PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NHERF-2 Products

Array NBP1-84944PEP

Blogs on NHERF-2

There are no specific blogs for NHERF-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZEB1 Antibody
NBP1-05987

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NHERF-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A3R2