Recombinant Human NHE3/SLC9A3 GST (N-Term) Protein

SDS-Page: Recombinant Human NHE3/SLC9A3 Protein [H00006550-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human NHE3/SLC9A3 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_004165.2) for Human NHE3/SLC9A3
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: GLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLARLPPWLSPGE

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: SLC9A3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 37.84 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NHE3/SLC9A3 GST (N-Term) Protein

• isoform 3
• MGC126718
• NHE3
• NHE3MGC126720
• SLC9A3
• solute carrier family 9 (sodium/hydrogen exchanger), member 3
• Solute carrier family 9 member 3

Background

NHE3 is a member of the Sodium/Hydrogen exchanger family that plays a crucial role in acid-base and volume homeostasis by mediating the majority of sodium and bicarbonate reabsorption in the proximal tubule of the kidney. Two PKA consensus sites have been discovered in rat NHE3, serine 552 and serine 605. Research suggests that dopamine-induced phosphorylation of these consensus sites inhibit NHE3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SLC9A3