NHE3/SLC9A3 Antibody

Images

 
Western Blot: NHE3/SLC9A3 Antibody [NBP1-80524] - Sample Tissue: Human RPMI-8226 Antibody Dilution: 1.0 ug/ml
Western Blot: NHE3/SLC9A3 Antibody [NBP1-80524] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NHE3/SLC9A3 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human SLC9A3. Peptide sequence AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SLC9A3 and was validated on Western blot.
Theoretical MW
93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NHE3/SLC9A3 Antibody

  • isoform 3
  • MGC126718
  • NHE3
  • NHE3MGC126720
  • SLC9A3
  • solute carrier family 9 (sodium/hydrogen exchanger), member 3
  • Solute carrier family 9 member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82576
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38280
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-35213
Species: Hu
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-20338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80524
Species: Hu
Applications: WB

Publications for NHE3/SLC9A3 Antibody (NBP1-80524) (0)

There are no publications for NHE3/SLC9A3 Antibody (NBP1-80524).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHE3/SLC9A3 Antibody (NBP1-80524) (0)

There are no reviews for NHE3/SLC9A3 Antibody (NBP1-80524). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHE3/SLC9A3 Antibody (NBP1-80524) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHE3/SLC9A3 Products

Bioinformatics Tool for NHE3/SLC9A3 Antibody (NBP1-80524)

Discover related pathways, diseases and genes to NHE3/SLC9A3 Antibody (NBP1-80524). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHE3/SLC9A3 Antibody (NBP1-80524)

Discover more about diseases related to NHE3/SLC9A3 Antibody (NBP1-80524).
 

Pathways for NHE3/SLC9A3 Antibody (NBP1-80524)

View related products by pathway.

PTMs for NHE3/SLC9A3 Antibody (NBP1-80524)

Learn more about PTMs related to NHE3/SLC9A3 Antibody (NBP1-80524).
 

Research Areas for NHE3/SLC9A3 Antibody (NBP1-80524)

Find related products by research area.

Blogs on NHE3/SLC9A3

There are no specific blogs for NHE3/SLC9A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHE3/SLC9A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A3
Entrez
Uniprot