NHE1/SLC9A1 Antibody


Western Blot: NHE1/SLC9A1 Antibody [NBP1-69427] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: PANC1 cell lysatesLC9A1 is supported by BioGPS gene expression data to be expressed in PANC1.

Product Details

Product Discontinued
View other related NHE1/SLC9A1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NHE1/SLC9A1 Antibody Summary

Synthetic peptides corresponding to SLC9A1(solute carrier family 9 (sodium/hydrogen exchanger), member 1) The peptide sequence was selected from the middle region of SLC9A1. Peptide sequence RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFP
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC9A1 and was validated on Western blot.
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NHE1/SLC9A1 Antibody

  • APNH
  • APNH1
  • APNHFLJ42224
  • Na(+)/H(+) antiporter, amiloride-sensitive
  • Na(+)/H(+) exchanger 1
  • Na+/H+, amiloride sensitive)
  • Na-Li countertransporter
  • NHE1
  • NHE-1
  • NHE1Na+/H+ antiporter, amiloride-sensitive
  • SLC9A1
  • sodium/hydrogen exchanger 1
  • solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter
  • solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter
  • solute carrier family 9 (sodium/hydrogen exchanger), member 1
  • Solute carrier family 9 member 1


The Na+/H+ antiporter (SLC9A1) is a ubiquitous membrane-bound enzyme involved in pH regulation of vertebrate cells. It is specifically inhibited by the diuretic drug amiloride and activated by a variety of signals including growth factors, mitogens, neuro


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP

Publications for NHE1/SLC9A1 Antibody (NBP1-69427) (0)

There are no publications for NHE1/SLC9A1 Antibody (NBP1-69427).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHE1/SLC9A1 Antibody (NBP1-69427) (0)

There are no reviews for NHE1/SLC9A1 Antibody (NBP1-69427). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHE1/SLC9A1 Antibody (NBP1-69427) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NHE1/SLC9A1 Products

Bioinformatics Tool for NHE1/SLC9A1 Antibody (NBP1-69427)

Discover related pathways, diseases and genes to NHE1/SLC9A1 Antibody (NBP1-69427). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHE1/SLC9A1 Antibody (NBP1-69427)

Discover more about diseases related to NHE1/SLC9A1 Antibody (NBP1-69427).

Pathways for NHE1/SLC9A1 Antibody (NBP1-69427)

View related products by pathway.

PTMs for NHE1/SLC9A1 Antibody (NBP1-69427)

Learn more about PTMs related to NHE1/SLC9A1 Antibody (NBP1-69427).

Blogs on NHE1/SLC9A1

There are no specific blogs for NHE1/SLC9A1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NHE1/SLC9A1 Antibody and receive a gift card or discount.


Gene Symbol SLC9A1