NHA2/SLC9B2/NHEDC2 Recombinant Protein Antigen

Images

 
There are currently no images for NHA2/SLC9B2/NHEDC2 Protein (NBP2-13348PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NHA2/SLC9B2/NHEDC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC9B2.

Source: E.coli

Amino Acid Sequence: PSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC9B2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-13348.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NHA2/SLC9B2/NHEDC2 Recombinant Protein Antigen

  • FLJ23984
  • Mitochondrial Na(+)/H(+) exchanger NHA2
  • mitochondrial sodium/hydrogen exchanger NHA2
  • Na(+)/H(+) exchanger-like domain-containing protein 2
  • Na+/H+ exchanger domain containing 2
  • NHA2
  • NHA2NHE10
  • NHE domain-containing protein 2
  • NHE10
  • NHEDC2
  • SLC9B2
  • Sodium/hydrogen exchanger-like domain-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-45460
Species: Hu, Mu, Rt, Po, Ch, Rb
Applications: WB, IHC, IP
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA
NBP1-98585
Species: Rt
Applications: WB
NBP2-45294
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IF
NB100-56173
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-71805
Species: Hu
Applications: WB, IP
NBP2-01992
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32463
Species: Hu
Applications: IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-59379
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-92843
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69123
Species: Mu, Rt
Applications: WB
NBP2-58673
Species: Hu
Applications: ICC/IF

Publications for NHA2/SLC9B2/NHEDC2 Protein (NBP2-13348PEP) (0)

There are no publications for NHA2/SLC9B2/NHEDC2 Protein (NBP2-13348PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHA2/SLC9B2/NHEDC2 Protein (NBP2-13348PEP) (0)

There are no reviews for NHA2/SLC9B2/NHEDC2 Protein (NBP2-13348PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NHA2/SLC9B2/NHEDC2 Protein (NBP2-13348PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional NHA2/SLC9B2/NHEDC2 Products

Bioinformatics Tool for NHA2/SLC9B2/NHEDC2 Protein (NBP2-13348PEP)

Discover related pathways, diseases and genes to NHA2/SLC9B2/NHEDC2 Protein (NBP2-13348PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NHA2/SLC9B2/NHEDC2

There are no specific blogs for NHA2/SLC9B2/NHEDC2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NHA2/SLC9B2/NHEDC2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9B2