NFATC3/NFAT4 Antibody (3A12) [PerCP]



Product Details

Product Discontinued
View other related NFATC3/NFAT4 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NFATC3/NFAT4 Antibody (3A12) [PerCP] Summary

NFATC3 (NP_775188, 70 a.a. - 149 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Store at 4C in the dark.
0.05% Sodium Azide
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NFATC3/NFAT4 Antibody (3A12) [PerCP]

  • NFAT4
  • NF-AT4
  • NFAT4nuclear factor of activated T-cells, cytoplasmic 3
  • NFATC3
  • NF-ATc3
  • nuclear factor of activated T-cells c3 isoform IE-Xa
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
  • T cell transcription factor NFAT4
  • T-cell transcription factor NFAT4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC-Fr, IHC-P, IP, S-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Rt
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for NFATC3/NFAT4 Antibody (H00004775-M02PCP) (0)

There are no publications for NFATC3/NFAT4 Antibody (H00004775-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFATC3/NFAT4 Antibody (H00004775-M02PCP) (0)

There are no reviews for NFATC3/NFAT4 Antibody (H00004775-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NFATC3/NFAT4 Antibody (H00004775-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NFATC3/NFAT4 Products

Bioinformatics Tool for NFATC3/NFAT4 Antibody (H00004775-M02PCP)

Discover related pathways, diseases and genes to NFATC3/NFAT4 Antibody (H00004775-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFATC3/NFAT4 Antibody (H00004775-M02PCP)

Discover more about diseases related to NFATC3/NFAT4 Antibody (H00004775-M02PCP).

Pathways for NFATC3/NFAT4 Antibody (H00004775-M02PCP)

View related products by pathway.

PTMs for NFATC3/NFAT4 Antibody (H00004775-M02PCP)

Learn more about PTMs related to NFATC3/NFAT4 Antibody (H00004775-M02PCP).

Research Areas for NFATC3/NFAT4 Antibody (H00004775-M02PCP)

Find related products by research area.

Blogs on NFATC3/NFAT4

There are no specific blogs for NFATC3/NFAT4, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NFATC3/NFAT4 Antibody (3A12) [PerCP] and receive a gift card or discount.


Gene Symbol NFATC3