Recombinant Human Neutrophil Elastase/ELA2 Protein

Images

 

Order Details


    • Catalog Number
      H00001991-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Neutrophil Elastase/ELA2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human ELA2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ELANE

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neutrophil Elastase/ELA2 Protein

  • Bone marrow serine protease
  • EC 3.4.21
  • EC 3.4.21.37
  • ELA2
  • ELA2granulocyte-derived elastase
  • ELANE
  • elastase 2, neutrophil
  • elastase, neutrophil expressed
  • Elastase-2
  • GE
  • HLEelastase-2
  • HNE
  • Human leukocyte elastase
  • Leukocyte Elastase
  • Medullasin
  • NE
  • Neutrophil Elastase
  • PMN elastase
  • PMN-E
  • polymorphonuclear elastase
  • SCN1

Background

ELA2 - elastase 2, neutrophil

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00001991-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01) (0)

There are no publications for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01) (0)

There are no reviews for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neutrophil Elastase/ELA2 Products

Bioinformatics Tool for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01)

Discover related pathways, diseases and genes to Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01)

Discover more about diseases related to Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01).
 

Pathways for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01)

View related products by pathway.

Research Areas for Neutrophil Elastase/ELA2 Partial Recombinant Protein (H00001991-Q01)

Find related products by research area.

Blogs on Neutrophil Elastase/ELA2

There are no specific blogs for Neutrophil Elastase/ELA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neutrophil Elastase/ELA2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ELANE
Entrez