Neutrophil Elastase/ELA2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ELANE |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Neutrophil Elastase/ELA2 Antibody - BSA Free
Background
The ELANE gene (commonly known as neutrophil elastase) encodes a 267 amino acid long, 28 kDA neutrophil elastase protein that functions in regulation of natural killer cells, monocytes, and graulocytes. ELANE is involved in activation of proMMP8, cell adhesion cell-matrix glycoconjugates, selected targets of C/EBPbeta, degradation of the extracellular matrix and collagen, and amb2 integrin signaling. It interacts with various genes GZMB, LRP1, SERPINF2, SERPING1, and SERPINA1. Elane has been linked to cystic fibrosis, asthma, pneumonia, alzheimer's disease, neutropenia, cutis laxia, leg ulcers, wegener's granulomatosis, bronchitis, adult respiratory distress syndrome, and vascular diseases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC
Publications for Neutrophil Elastase/ELA2 Antibody (NBP2-57576) (0)
There are no publications for Neutrophil Elastase/ELA2 Antibody (NBP2-57576).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neutrophil Elastase/ELA2 Antibody (NBP2-57576) (0)
There are no reviews for Neutrophil Elastase/ELA2 Antibody (NBP2-57576).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Neutrophil Elastase/ELA2 Antibody (NBP2-57576) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neutrophil Elastase/ELA2 Products
Research Areas for Neutrophil Elastase/ELA2 Antibody (NBP2-57576)
Find related products by research area.
|
Blogs on Neutrophil Elastase/ELA2