Neutrophil Elastase/ELA2 Antibody

Images

 
Immunohistochemistry-Paraffin: Neutrophil Elastase/ELA2 Antibody [NBP2-57576] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Neutrophil Elastase/ELA2 Antibody [NBP2-57576] - Staining of human bone marrow shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neutrophil Elastase/ELA2 Antibody [NBP2-57576] - Staining in human bone marrow and cerebral cortex tissues using anti-ELANE antibody. Corresponding ELANE ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Neutrophil Elastase/ELA2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHP
Specificity
Specificity of human Neutrophil Elastase/ELA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELANE
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neutrophil Elastase/ELA2 Recombinant Protein Antigen (NBP2-57576PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Neutrophil Elastase/ELA2 Antibody

  • Bone marrow serine protease
  • EC 3.4.21
  • EC 3.4.21.37
  • ELA2
  • ELA2granulocyte-derived elastase
  • ELANE
  • elastase 2, neutrophil
  • elastase, neutrophil expressed
  • Elastase-2
  • GE
  • HLEelastase-2
  • HNE
  • Human leukocyte elastase
  • Leukocyte Elastase
  • Medullasin
  • NE
  • Neutrophil Elastase
  • PMN elastase
  • PMN-E
  • polymorphonuclear elastase
  • SCN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-26116
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-32005
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-90309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Neutrophil Elastase/ELA2 Antibody (NBP2-57576) (0)

There are no publications for Neutrophil Elastase/ELA2 Antibody (NBP2-57576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neutrophil Elastase/ELA2 Antibody (NBP2-57576) (0)

There are no reviews for Neutrophil Elastase/ELA2 Antibody (NBP2-57576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neutrophil Elastase/ELA2 Antibody (NBP2-57576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Neutrophil Elastase/ELA2 Products

Bioinformatics Tool for Neutrophil Elastase/ELA2 Antibody (NBP2-57576)

Discover related pathways, diseases and genes to Neutrophil Elastase/ELA2 Antibody (NBP2-57576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neutrophil Elastase/ELA2 Antibody (NBP2-57576)

Discover more about diseases related to Neutrophil Elastase/ELA2 Antibody (NBP2-57576).
 

Pathways for Neutrophil Elastase/ELA2 Antibody (NBP2-57576)

View related products by pathway.

Research Areas for Neutrophil Elastase/ELA2 Antibody (NBP2-57576)

Find related products by research area.

Blogs on Neutrophil Elastase/ELA2

There are no specific blogs for Neutrophil Elastase/ELA2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neutrophil Elastase/ELA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELANE