Neutrophil Elastase/ELA2 Antibody (4E12.)

Images

 
ELISA: Neutrophil Elastase Antibody (4E12) [H00001991-M04C] - Detection limit for recombinant GST tagged ELA2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4E12.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Neutrophil Elastase/ELA2 Antibody (4E12.) Summary

Immunogen
ELA2 (NP_001963 168 a.a. - 267 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Specificity
ELA2 - elastase 2, neutrophil (4E12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ELANE
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Neutrophil Elastase/ELA2 Antibody (4E12.)

  • Bone marrow serine protease
  • EC 3.4.21
  • EC 3.4.21.37
  • ELA2
  • ELA2granulocyte-derived elastase
  • ELANE
  • elastase 2, neutrophil
  • elastase, neutrophil expressed
  • Elastase-2
  • GE
  • HLEelastase-2
  • HNE
  • Human leukocyte elastase
  • Leukocyte Elastase
  • Medullasin
  • NE
  • Neutrophil Elastase
  • PMN elastase
  • PMN-E
  • polymorphonuclear elastase
  • SCN1

Background

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Elastase 2 hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix following the protein's release from activated neutrophils. Elastase 2 may play a role in degenerative and inflammatory diseases by its proteolysis of collagen-IV and elastin of the extracellular matrix. This protein degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is clustered with other serine protease gene family members, azurocidin 1 and proteinase 3 genes, at chromosome 19pter. All 3 genes are expressed coordinately and their protein products are packaged together into azurophil granules during neutrophil differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00001991-M04C
Species: Hu
Applications: ELISA

Publications for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C) (0)

There are no publications for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C) (0)

There are no reviews for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neutrophil Elastase/ELA2 Products

Bioinformatics Tool for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C)

Discover related pathways, diseases and genes to Neutrophil Elastase/ELA2 Antibody (H00001991-M04C). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C)

Discover more about diseases related to Neutrophil Elastase/ELA2 Antibody (H00001991-M04C).
 

Pathways for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C)

View related products by pathway.

Research Areas for Neutrophil Elastase/ELA2 Antibody (H00001991-M04C)

Find related products by research area.

Blogs on Neutrophil Elastase/ELA2

There are no specific blogs for Neutrophil Elastase/ELA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neutrophil Elastase/ELA2 Antibody (4E12.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ELANE
Entrez
Uniprot