Recombinant Human Neurotrophin 3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Neurotrophin 3 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 19 - 128 of Human NTF3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NTF3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neurotrophin 3 Protein

  • HDNF
  • MGC129711
  • Nerve growth factor 2
  • Neurotrophic factor
  • neurotrophin 3
  • neurotrophin-3
  • NGF2
  • NGF-2
  • NT3
  • NT-3

Background

NTF3 - neurotrophin 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
557-NT/CF
Species: Rt
NB110-40561
Species: Hu
Applications: WB, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
H00004908-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01) (0)

There are no publications for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01) (0)

There are no reviews for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurotrophin 3 Products

Bioinformatics Tool for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01)

Discover related pathways, diseases and genes to Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01)

Discover more about diseases related to Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01).
 

Pathways for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01)

View related products by pathway.

PTMs for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01)

Learn more about PTMs related to Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01).
 

Research Areas for Neurotrophin 3 Partial Recombinant Protein (H00004908-Q01)

Find related products by research area.

Blogs on Neurotrophin 3

There are no specific blogs for Neurotrophin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neurotrophin 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NTF3