Neuropeptide Y Antibody (3H2)

Images

 
ELISA: Neuropeptide Y Antibody (3H2) [H00004852-M06] - Detection limit for recombinant GST tagged NPY is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Neuropeptide Y Antibody (3H2) Summary

Immunogen
NPY (AAH29497, 29 a.a. - 97 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Specificity
NPY - neuropeptide Y (3H2)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NPY
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Neuropeptide Y Antibody (3H2)

  • 170 kDa melanoma membrane-bound gelatinase
  • DKFZp686G13158
  • DPPIV
  • EC 3.4.21.-
  • FAPA
  • Fibroblast activation protein alpha
  • fibroblast activation protein, alpha
  • Integral membrane serine protease
  • Neuropeptide Y
  • NPY
  • PYY4
  • seprase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
H00004852-M06
Species: Hu
Applications: WB, ELISA

Publications for Neuropeptide Y Antibody (H00004852-M06) (0)

There are no publications for Neuropeptide Y Antibody (H00004852-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuropeptide Y Antibody (H00004852-M06) (0)

There are no reviews for Neuropeptide Y Antibody (H00004852-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuropeptide Y Antibody (H00004852-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuropeptide Y Products

Bioinformatics Tool for Neuropeptide Y Antibody (H00004852-M06)

Discover related pathways, diseases and genes to Neuropeptide Y Antibody (H00004852-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuropeptide Y Antibody (H00004852-M06)

Discover more about diseases related to Neuropeptide Y Antibody (H00004852-M06).
 

Pathways for Neuropeptide Y Antibody (H00004852-M06)

View related products by pathway.

PTMs for Neuropeptide Y Antibody (H00004852-M06)

Learn more about PTMs related to Neuropeptide Y Antibody (H00004852-M06).
 

Research Areas for Neuropeptide Y Antibody (H00004852-M06)

Find related products by research area.

Blogs on Neuropeptide Y

There are no specific blogs for Neuropeptide Y, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuropeptide Y Antibody (3H2) and receive a gift card or discount.

Bioinformatics

Gene Symbol NPY
Entrez
Uniprot