Neuromedin U R1/NMUR1 Antibody

Images

 
Immunohistochemistry-Paraffin: Neuromedin U R1/NMUR1 Antibody [NBP1-83433] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neuromedin U R1/NMUR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMUR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuromedin U R1/NMUR1 Protein (NBP1-83433PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuromedin U R1/NMUR1 Antibody

  • (FM-3)
  • FM3
  • FM-3
  • G protein-coupled receptor 66
  • GPC-R
  • GPR66
  • GPR66G-protein coupled receptor 66
  • G-protein coupled receptor FM-3
  • Neuromedin U R1
  • neuromedin U receptor 1
  • Neuromedin UR1
  • neuromedin-U receptor 1
  • NMU1R
  • NMUR1
  • NMU-R1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-02351
Species: Hu, Rt
Applications: EM, ELISA, IHC, IHC-Fr, IHC-P
NBP1-87452
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87515
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87515
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB8370
Species: Hu
Applications: Flow, CyTOF-ready
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NLS418
Species: Hu
Applications: IHC-P
MAB8200
Species: Hu, Mu
Applications: IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for Neuromedin U R1/NMUR1 Antibody (NBP1-83433) (0)

There are no publications for Neuromedin U R1/NMUR1 Antibody (NBP1-83433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuromedin U R1/NMUR1 Antibody (NBP1-83433) (0)

There are no reviews for Neuromedin U R1/NMUR1 Antibody (NBP1-83433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neuromedin U R1/NMUR1 Antibody (NBP1-83433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuromedin U R1/NMUR1 Products

Bioinformatics Tool for Neuromedin U R1/NMUR1 Antibody (NBP1-83433)

Discover related pathways, diseases and genes to Neuromedin U R1/NMUR1 Antibody (NBP1-83433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuromedin U R1/NMUR1 Antibody (NBP1-83433)

Discover more about diseases related to Neuromedin U R1/NMUR1 Antibody (NBP1-83433).
 

Pathways for Neuromedin U R1/NMUR1 Antibody (NBP1-83433)

View related products by pathway.

PTMs for Neuromedin U R1/NMUR1 Antibody (NBP1-83433)

Learn more about PTMs related to Neuromedin U R1/NMUR1 Antibody (NBP1-83433).
 

Research Areas for Neuromedin U R1/NMUR1 Antibody (NBP1-83433)

Find related products by research area.

Blogs on Neuromedin U R1/NMUR1

There are no specific blogs for Neuromedin U R1/NMUR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuromedin U R1/NMUR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMUR1
Entrez