Recombinant Human Neuroligin 4Y/NLGN4Y Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Neuroligin 4Y/NLGN4Y Peptides and Proteins

Order Details


    • Catalog Number
      H00022829-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Neuroligin 4Y/NLGN4Y Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-134 of Human NLGN4Y full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
NLGN4Y

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neuroligin 4Y/NLGN4Y Protein

  • neuroligin 4, Y-linked
  • Neuroligin 4Y
  • Neuroligin Y
  • neuroligin-4, Y-linked
  • NLGN4Y
  • Y linked

Background

NLGN4Y( AAH32567, 1 a.a. - 135 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42200
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
AF5158
Species: Hu
Applications: WB, IHC
AF4340
Species: Hu, Rt
Applications: WB, IHC
NBP2-41299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01) (0)

There are no publications for Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01) (0)

There are no reviews for Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neuroligin 4Y/NLGN4Y Products

Bioinformatics Tool for Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01)

Discover related pathways, diseases and genes to Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01)

Discover more about diseases related to Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01).
 

Pathways for Neuroligin 4Y/NLGN4Y Recombinant Protein (H00022829-P01)

View related products by pathway.

Blogs on Neuroligin 4Y/NLGN4Y

There are no specific blogs for Neuroligin 4Y/NLGN4Y, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neuroligin 4Y/NLGN4Y Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NLGN4Y
Entrez