Recombinant Human Neuroligin 4X/NLGN4X Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Neuroligin 4X/NLGN4X Peptides and Proteins

Order Details


    • Catalog Number
      H00057502-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Neuroligin 4X/NLGN4X Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 577-676 of Human NLGN4X partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NLGN4X

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neuroligin 4X/NLGN4X Protein

  • ASPGX2
  • AUTSX2
  • HLNX
  • HNL4X
  • HNLX
  • KIAA1260AUTSX2
  • MGC22376
  • neuroligin 4, X-linked
  • Neuroligin 4X
  • NL4
  • NLGN
  • NLGN4
  • NLGN4neuroligin 4
  • NLGN4X
  • X-linked

Background

NLGN4X - neuroligin 4, X-linked

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42200
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
AF4340
Species: Hu, Rt
Applications: WB, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF4524
Species: Rt
Applications: WB
NBP2-41299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47610
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
H00051481-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62667
Species: Hu
Applications: WB
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-88828
Species: Hu
Applications: IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-46770
Species: Hu
Applications: IHC, IHC-P
NBP2-55181
Species: Hu
Applications: ICC/IF

Publications for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01) (0)

There are no publications for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01) (0)

There are no reviews for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neuroligin 4X/NLGN4X Products

Bioinformatics Tool for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01)

Discover related pathways, diseases and genes to Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01)

Discover more about diseases related to Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01).
 

Pathways for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01)

View related products by pathway.

PTMs for Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01)

Learn more about PTMs related to Neuroligin 4X/NLGN4X Partial Recombinant Protein (H00057502-Q01).

Blogs on Neuroligin 4X/NLGN4X

There are no specific blogs for Neuroligin 4X/NLGN4X, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neuroligin 4X/NLGN4X Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NLGN4X
Entrez