NeuroD2 Antibody


Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - Staining of liver cancer.
Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - Staining of placenta.

Product Details

Product Discontinued
View other related NeuroD2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NeuroD2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPLYE
Specificity of human NeuroD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry -2146826246
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NeuroD2 Antibody

  • BHLHA1
  • bHLHa1neurogenic differentiation factor 2
  • Class A basic helix-loop-helix protein 1
  • MGC26304
  • NDRF
  • NDRFneurogenic basic-helix-loop-helix protein
  • NeuroD2
  • NeuroD-related factor
  • neurogenic differentiation 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
Species: Mu
Applications: WB, IHC
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu, Rt
Applications: WB, ELISA, Single Cell Western
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Mu
Applications: IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
Species: Hu
Applications: IHC

Publications for NeuroD2 Antibody (NBP2-32545) (0)

There are no publications for NeuroD2 Antibody (NBP2-32545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NeuroD2 Antibody (NBP2-32545) (0)

There are no reviews for NeuroD2 Antibody (NBP2-32545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NeuroD2 Antibody (NBP2-32545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NeuroD2 Products

Bioinformatics Tool for NeuroD2 Antibody (NBP2-32545)

Discover related pathways, diseases and genes to NeuroD2 Antibody (NBP2-32545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NeuroD2 Antibody (NBP2-32545)

Discover more about diseases related to NeuroD2 Antibody (NBP2-32545).

Pathways for NeuroD2 Antibody (NBP2-32545)

View related products by pathway.

PTMs for NeuroD2 Antibody (NBP2-32545)

Learn more about PTMs related to NeuroD2 Antibody (NBP2-32545).

Research Areas for NeuroD2 Antibody (NBP2-32545)

Find related products by research area.

Blogs on NeuroD2

There are no specific blogs for NeuroD2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NeuroD2 Antibody and receive a gift card or discount.


Gene Symbol NEUROD2