NeuroD2 Antibody

Images

 
Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - Staining of liver cancer.
Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry: NeuroD2 Antibody [NBP2-32545] - Staining of placenta.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NeuroD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPLYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEUROD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NeuroD2 Antibody

  • BHLHA1
  • bHLHa1neurogenic differentiation factor 2
  • Class A basic helix-loop-helix protein 1
  • MGC26304
  • NDRF
  • NDRFneurogenic basic-helix-loop-helix protein
  • NeuroD2
  • NeuroD-related factor
  • neurogenic differentiation 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP2-29865
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
AF2567
Species: Mu
Applications: WB, IHC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00058158-B02P
Species: Hu
Applications: WB, ELISA
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
MAB3314
Species: Hu, Rt
Applications: IHC
AF4937
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-31318
Species: Mu
Applications: IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-32545
Species: Hu
Applications: IHC

Publications for NeuroD2 Antibody (NBP2-32545) (0)

There are no publications for NeuroD2 Antibody (NBP2-32545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NeuroD2 Antibody (NBP2-32545) (0)

There are no reviews for NeuroD2 Antibody (NBP2-32545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NeuroD2 Antibody (NBP2-32545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NeuroD2 Products

Bioinformatics Tool for NeuroD2 Antibody (NBP2-32545)

Discover related pathways, diseases and genes to NeuroD2 Antibody (NBP2-32545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NeuroD2 Antibody (NBP2-32545)

Discover more about diseases related to NeuroD2 Antibody (NBP2-32545).
 

Pathways for NeuroD2 Antibody (NBP2-32545)

View related products by pathway.

PTMs for NeuroD2 Antibody (NBP2-32545)

Learn more about PTMs related to NeuroD2 Antibody (NBP2-32545).
 

Research Areas for NeuroD2 Antibody (NBP2-32545)

Find related products by research area.

Blogs on NeuroD2

There are no specific blogs for NeuroD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NeuroD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEUROD2
Entrez