Recombinant Human Neurocan Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Neurocan Peptides and Proteins

Order Details


    • Catalog Number
      H00001463-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Neurocan Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-99 of Human CSPG3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NCAN

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neurocan Protein

  • chondroitin sulfate proteoglycan 3 (neurocan)
  • Chondroitin sulfate proteoglycan 3
  • CSPG3
  • CSPG3neurocan core protein
  • FLJ44681
  • NCAN
  • NEUR
  • neurocan proteoglycan
  • Neurocan

Background

CSPG3 - chondroitin sulfate proteoglycan 3 (neurocan)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2688
Species: Hu
Applications: WB
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4009
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF3865
Species: Hu
Applications: WB, IHC
NBP2-57712
Species: Hu
Applications: ICC/IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Neurocan Partial Recombinant Protein (H00001463-Q01) (0)

There are no publications for Neurocan Partial Recombinant Protein (H00001463-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurocan Partial Recombinant Protein (H00001463-Q01) (0)

There are no reviews for Neurocan Partial Recombinant Protein (H00001463-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurocan Partial Recombinant Protein (H00001463-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurocan Products

Bioinformatics Tool for Neurocan Partial Recombinant Protein (H00001463-Q01)

Discover related pathways, diseases and genes to Neurocan Partial Recombinant Protein (H00001463-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurocan Partial Recombinant Protein (H00001463-Q01)

Discover more about diseases related to Neurocan Partial Recombinant Protein (H00001463-Q01).
 

Pathways for Neurocan Partial Recombinant Protein (H00001463-Q01)

View related products by pathway.

PTMs for Neurocan Partial Recombinant Protein (H00001463-Q01)

Learn more about PTMs related to Neurocan Partial Recombinant Protein (H00001463-Q01).

Blogs on Neurocan

There are no specific blogs for Neurocan, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neurocan Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAN
Entrez