Neurexophilin-1 Antibody

Images

 
Western Blot: NXPH1 Antibody [NBP1-74116] - Mouse Small Intestine Lystae 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related Neurexophilin-1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74116
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Neurexophilin-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Nxph1. Immunizing peptide sequence LLQPTVYLVTCANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLS.
Clonality
Polyclonal
Host
Rabbit
Gene
NXPH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Nxph1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Neurexophilin-1 Antibody

  • neurexophilin 1
  • Neurexophilin1
  • Neurexophilin-1
  • NPH1
  • NXPH1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
AF5098
Species: Hu, Mu, Rt
Applications: WB
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
H00004867-D01P
Species: Hu, Mu
Applications: WB
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-06188
Species: Hu
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4524
Species: Rt
Applications: WB
H00011247-T01
Species: Hu
NBP1-87380
Species: Hu
Applications: IHC, IHC-P
NBP2-14215
Species: Hu
Applications: IHC, IHC-P
H00027130-P02
Species: Hu
AF4084
Species: Hu
Applications: WB, IHC, ICFlow
H00080333-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-28870
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
H00221823-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-74116
Species: Mu
Applications: WB

Publications for Neurexophilin-1 Antibody (NBP1-74116) (0)

There are no publications for Neurexophilin-1 Antibody (NBP1-74116).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurexophilin-1 Antibody (NBP1-74116) (0)

There are no reviews for Neurexophilin-1 Antibody (NBP1-74116). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurexophilin-1 Antibody (NBP1-74116) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neurexophilin-1 Products

Bioinformatics Tool for Neurexophilin-1 Antibody (NBP1-74116)

Discover related pathways, diseases and genes to Neurexophilin-1 Antibody (NBP1-74116). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurexophilin-1 Antibody (NBP1-74116)

Discover more about diseases related to Neurexophilin-1 Antibody (NBP1-74116).
 

Pathways for Neurexophilin-1 Antibody (NBP1-74116)

View related products by pathway.

PTMs for Neurexophilin-1 Antibody (NBP1-74116)

Learn more about PTMs related to Neurexophilin-1 Antibody (NBP1-74116).

Blogs on Neurexophilin-1

There are no specific blogs for Neurexophilin-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurexophilin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NXPH1
Entrez