Recombinant Human Neudesin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Neudesin Peptides and Proteins

Order Details


    • Catalog Number
      H00029937-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Neudesin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-172 of Human NENF full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
NENF

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neudesin Protein

  • Cell immortalization-related protein 2
  • CIR2
  • CIR2cell growth-inhibiting protein 47
  • NENF
  • Neudesin
  • neuron derived neurotrophic factor
  • Neuron-derived neurotrophic factor
  • SCIRP10
  • SCIRP10-related protein
  • Secreted protein of unknown function
  • Spinal cord injury related protein 10
  • SPUF protein
  • SPUF
  • SPUFneudesin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56397
Species: Hu
Applications: WB
H00009541-M01
Species: Hu
Applications: WB, ELISA
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000797-B02P-50ug
Species: Hu
Applications: WB, ICC/IF
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBL1-08472
Species: Hu
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4414
Species: Hu
Applications: WB, IHC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-57578
Species: Hu
Applications: WB
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00029937-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Neudesin Recombinant Protein (H00029937-P01) (0)

There are no publications for Neudesin Recombinant Protein (H00029937-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neudesin Recombinant Protein (H00029937-P01) (0)

There are no reviews for Neudesin Recombinant Protein (H00029937-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neudesin Recombinant Protein (H00029937-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neudesin Products

Bioinformatics Tool for Neudesin Recombinant Protein (H00029937-P01)

Discover related pathways, diseases and genes to Neudesin Recombinant Protein (H00029937-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neudesin Recombinant Protein (H00029937-P01)

Discover more about diseases related to Neudesin Recombinant Protein (H00029937-P01).
 

Pathways for Neudesin Recombinant Protein (H00029937-P01)

View related products by pathway.

Blogs on Neudesin

There are no specific blogs for Neudesin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neudesin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NENF
Entrez