Netrin 3 Antibody

Images

 
Western Blot: Netrin 3 Antibody [NBP2-30487] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry: Netrin 3 Antibody [NBP2-30487] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Netrin 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NTN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Netrin 3 Protein (NBP2-30487PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Netrin 3 Antibody

  • netrin 2 (chicken)-like
  • netrin 2-like (chicken)
  • Netrin 3
  • Netrin-2, Chicken, Homolog Of, Like
  • Netrin-2-Like Protein
  • Netrin-3
  • NTN2L
  • NTN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF844
Species: Mu
Applications: WB, Block
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
AF1006
Species: Rt
Applications: WB, IHC
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
AF1005
Species: Hu
Applications: WB, IHC
NBP2-03726
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
6514-SL
Species: Hu
AF2429
Species: Mu
Applications: WB, IHC
AF482
Species: Mu
Applications: WB, IHC
NBP2-33988
Species: Hu
Applications: WB, IHC, IHC-P
MAB5579
Species: Hu
Applications: ICC
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2864
Species: Hu
Applications: WB, ICC
AF1749
Species: Rt
Applications: WB, IHC
AF1784
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICFlow
NBP2-30487
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Netrin 3 Antibody (NBP2-30487) (0)

There are no publications for Netrin 3 Antibody (NBP2-30487).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Netrin 3 Antibody (NBP2-30487) (0)

There are no reviews for Netrin 3 Antibody (NBP2-30487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Netrin 3 Antibody (NBP2-30487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Netrin 3 Products

Netrin 3 NBP2-30487

Bioinformatics Tool for Netrin 3 Antibody (NBP2-30487)

Discover related pathways, diseases and genes to Netrin 3 Antibody (NBP2-30487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Netrin 3 Antibody (NBP2-30487)

Discover more about diseases related to Netrin 3 Antibody (NBP2-30487).
 

Pathways for Netrin 3 Antibody (NBP2-30487)

View related products by pathway.

Blogs on Netrin 3

There are no specific blogs for Netrin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Netrin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTN3
Uniprot