Recombinant Human Netrin-1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Netrin-1 Peptides and Proteins

Order Details


    • Catalog Number
      H00009423-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Netrin-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 495-604 of Human NTN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKKA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NTN1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
5 mM Tris, pH 8.0

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Netrin-1 Protein

  • netrin 1
  • Netrin1
  • Netrin-1
  • NTN1
  • NTN1Lnetrin 1, mouse, homolog of

Background

NTN1 - netrin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF844
Species: Mu
Applications: WB, Block
AF1006
Species: Rt
Applications: WB, IHC
AF1005
Species: Hu
Applications: WB, IHC
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
AF1405
Species: Rt
Applications: WB, Block, ICC
6514-SL
Species: Hu
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1166
Species: Mu
Applications: WB
AF3147
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
H00009423-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Netrin-1 Partial Recombinant Protein (H00009423-Q01) (0)

There are no publications for Netrin-1 Partial Recombinant Protein (H00009423-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Netrin-1 Partial Recombinant Protein (H00009423-Q01) (0)

There are no reviews for Netrin-1 Partial Recombinant Protein (H00009423-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Netrin-1 Partial Recombinant Protein (H00009423-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Netrin-1 Products

Bioinformatics Tool for Netrin-1 Partial Recombinant Protein (H00009423-Q01)

Discover related pathways, diseases and genes to Netrin-1 Partial Recombinant Protein (H00009423-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Netrin-1 Partial Recombinant Protein (H00009423-Q01)

Discover more about diseases related to Netrin-1 Partial Recombinant Protein (H00009423-Q01).
 

Pathways for Netrin-1 Partial Recombinant Protein (H00009423-Q01)

View related products by pathway.

PTMs for Netrin-1 Partial Recombinant Protein (H00009423-Q01)

Learn more about PTMs related to Netrin-1 Partial Recombinant Protein (H00009423-Q01).
 

Research Areas for Netrin-1 Partial Recombinant Protein (H00009423-Q01)

Find related products by research area.

Blogs on Netrin-1

There are no specific blogs for Netrin-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Netrin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NTN1
Entrez