NEK3 Antibody (2F8) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related NEK3 Primary Antibodies

Order Details


    • Catalog Number
      H00004752-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NEK3 Antibody (2F8) [PerCP] Summary

Immunogen
NEK3 (AAH19916 406 a.a. - 506 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDWVSELKKRAGWQGLCDR
Specificity
NEK3 - NIMA (never in mitosis gene a)-related kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NEK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEK3 Antibody (2F8) [PerCP]

  • EC 2.7.11
  • EC 2.7.11.1
  • glycogen synthase A kinase
  • HSPK 36
  • HSPK36
  • hydroxyalkyl-protein kinase
  • MGC29949
  • Never in mitosis A-related kinase 3
  • NIMA (never in mitosis gene a)-related kinase 3
  • NimA-related protein kinase 3
  • phosphorylase B kinase kinase
  • serine/threonine-protein kinase Nek3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27078
Species: Hu, Ca, Pm
Applications: WB
NBP1-42686
Species: Hu
Applications: WB (-), IHC, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-82539
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB7307
Species: Rt
Applications: WB, Flow, CyTOF-ready, Neut
H00079858-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31110
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for NEK3 Antibody (H00004752-M01PCP) (0)

There are no publications for NEK3 Antibody (H00004752-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK3 Antibody (H00004752-M01PCP) (0)

There are no reviews for NEK3 Antibody (H00004752-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEK3 Antibody (H00004752-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK3 Products

Bioinformatics Tool for NEK3 Antibody (H00004752-M01PCP)

Discover related pathways, diseases and genes to NEK3 Antibody (H00004752-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK3 Antibody (H00004752-M01PCP)

Discover more about diseases related to NEK3 Antibody (H00004752-M01PCP).
 

Pathways for NEK3 Antibody (H00004752-M01PCP)

View related products by pathway.

PTMs for NEK3 Antibody (H00004752-M01PCP)

Learn more about PTMs related to NEK3 Antibody (H00004752-M01PCP).
 

Research Areas for NEK3 Antibody (H00004752-M01PCP)

Find related products by research area.

Blogs on NEK3

There are no specific blogs for NEK3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK3 Antibody (2F8) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK3