Necdin Antibody (1B3) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Necdin Primary Antibodies

Order Details


    • Catalog Number
      H00004692-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Necdin Antibody (1B3) [PerCP] Summary

Immunogen
NDN (NP_002478 222 a.a. - 321 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Specificity
NDN - necdin homolog (mouse)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Necdin Antibody (1B3) [PerCP]

  • HsT16328
  • necdin (mouse) homolog
  • necdin homolog (mouse)
  • necdin
  • PWCR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB38352
Species: Hu, Mu
Applications: WB, ICC
NBP1-02509
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-84320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-240
Species: Hu, Mu
Applications: WB, IP
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
H00006047-A01
Species: Hu
Applications: WB, ELISA
H00008926-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Necdin Antibody (H00004692-M02PCP) (0)

There are no publications for Necdin Antibody (H00004692-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Necdin Antibody (H00004692-M02PCP) (0)

There are no reviews for Necdin Antibody (H00004692-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Necdin Antibody (H00004692-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Necdin Products

Bioinformatics Tool for Necdin Antibody (H00004692-M02PCP)

Discover related pathways, diseases and genes to Necdin Antibody (H00004692-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Necdin Antibody (H00004692-M02PCP)

Discover more about diseases related to Necdin Antibody (H00004692-M02PCP).
 

Pathways for Necdin Antibody (H00004692-M02PCP)

View related products by pathway.

PTMs for Necdin Antibody (H00004692-M02PCP)

Learn more about PTMs related to Necdin Antibody (H00004692-M02PCP).
 

Research Areas for Necdin Antibody (H00004692-M02PCP)

Find related products by research area.

Blogs on Necdin

There are no specific blogs for Necdin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Necdin Antibody (1B3) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol NDN